KEGG   Geobacter sulfurreducens PCA: GSU1216Help
Entry
GSU1216           CDS       T00155                                 

Gene name
cydC
Definition
(RefSeq) thiol reductant ABC exporter, ATP-binding protein CydC
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
gsu  Geobacter sulfurreducens PCA
Pathway
gsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:gsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    GSU1216 (cydC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gsu02000]
    GSU1216 (cydC)
Transporters [BR:gsu02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    GSU1216 (cydC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 AAA_16 ABC_membrane AAA_25 AAA_18 AAA_22 AAA_33 Cytidylate_kin
Motif
Other DBs
NCBI-GeneID: 2686716
NCBI-ProteinID: NP_952269
UniProt: Q74DU9
LinkDB All DBs
Position
1319804..1321450
Genome map
AA seq 548 aa AA seqDB search
MRELFRILAVARGQWSWMAAGMLLAVAVIAANALLMAVSGWFIASMAVAGTTGAAFNYFF
PSAAIRGLAILRTVGRYLERLVTHEAGFRVLALLRVWLFRRLEPLAPATLERLGGGDVAG
RLRSDVDALESLYLRIMLPLAAGGGAILAATAFVALWSTSAAGVLFLALLAAGVGLPLVA
RRLAEQPGRRSAELAGSLREAVTEGLQGGEELILLGAVERQASLVDDLSRRLVAEQERLA
AGGGVTLAGGIVCGGVGVAAVLAIASFQVAAGELGGPLLVMLLLFAAAAFEAAGGMPAAL
QHLPAARESARRILELADSPPPVPEPATPVPLPATTEIVFRNVSFSHDPSLPVLRDVNLT
VPAGGRVALMGPSGSGKSTVADILLRFRDYGGSVTLGGIELRDLGGEAIRGLIAVVPQQP
HLFNGTIRENILLGNPAAEEEQVRRAVRDAALAEWVDGLPLGLDTPVGEGGSAVSGGEAR
RIALARALLKDAPVFLLDEPTEGLDFATEQRVIAALANRTEGKTVLIISHRPACGDMAEQ
VHYFVKVP
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgagagagctcttccgtatcctcgccgtggcccgcggacagtggtcatggatggcggcc
ggcatgctcctcgccgtggccgttatcgctgccaacgcccttctcatggcagtttccggc
tggttcatcgcctccatggccgttgccggcaccacgggcgccgccttcaactactttttc
ccctcggccgccatccgcgggctcgccatcctgcggaccgtggggcgctacctggagcgc
ctggtgacccacgaggccggcttccgggtccttgccctcctgcgcgtctggctcttccgg
cggcttgagcccctggcgccggcaacgctggagcggttgggcgggggagacgtggccggg
aggctccggtcggacgtggatgccctggaaagtctctatctgcggatcatgctccctctc
gccgccggtgggggggctatcctggctgcaacggcttttgttgccctctggagcacctct
gccgccggagttctttttctcgcactgctggccgccggggtgggcctgcccctggtggcg
cgccgattggcggagcagcccggccgccgttccgccgaactggccggcagcctgcgggaa
gccgtgaccgaagggcttcagggcggcgaggagctgatcctgctgggggcggtcgagcgt
caggcgtcgctggttgatgatctttcgcgacggctggtggcggagcaggagcgtctggcg
gcaggaggaggcgtcaccctggcgggtgggattgtctgcggcggggtcggggtggccgca
gtccttgcgattgcatcctttcaggttgccgccggggaactcggcggaccgctgctggtg
atgctgctactctttgccgcggctgccttcgaggctgccggcggaatgcccgctgcgctc
cagcacctgccagccgcccgggagtcggcgcgaagaattctcgaactggccgattcaccg
ccgccggtgccggaacccgctacgccggtgcctctcccggccaccacggagatcgtcttc
cgcaacgtctcgttctcccatgacccctctctgccggtactccgggacgttaacctgacc
gtgcccgccgggggacgggtagcgctcatgggccccagcggctcgggcaagagtaccgtg
gccgacatcctccttcgcttccgcgattacgggggaagcgtcaccctggggggcatcgaa
ctccgtgacctgggaggggaggctattcgcgggctgatcgctgtggttccccaacagccc
cacctcttcaacggcaccatcagagagaatatccttctgggcaacccggcggccgaagag
gagcaggtgcgtcgggctgtccgggatgctgcccttgccgagtgggtcgacggattgccc
ctgggtctggataccccggtgggtgagggggggagtgccgtgtcgggaggagaggcccgc
cggatcgccctggcccgggccctgttgaaggatgcaccggtttttctgctggacgagccc
accgaggggctcgacttcgccaccgaacaacgggtgattgcagcgctggcgaatcggacc
gaggggaagaccgtgctgatcatttcccaccgtccagcttgtggtgacatggctgaacag
gtgcactattttgttaaagttccctga

DBGET integrated database retrieval system