KEGG   Geobacter sulfurreducens PCA: GSU2761Help
Entry
GSU2761           CDS       T00155                                 

Gene name
glpA
Definition
(RefSeq) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
gsu  Geobacter sulfurreducens PCA
Pathway
gsu00564  Glycerophospholipid metabolism
gsu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gsu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    GSU2761 (glpA)
Enzymes [BR:gsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     GSU2761 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored HI0933_like NAD_binding_8 GIDA Pyr_redox_3 Pyr_redox_2
Motif
Other DBs
NCBI-GeneID: 2687006
NCBI-ProteinID: NP_953805
UniProt: Q749I2
LinkDB All DBs
Position
complement(3041513..3043066)
Genome map
AA seq 517 aa AA seqDB search
MKREDLLRHLAETEVWDMIVIGGGATGLGTAVEAAGRGYRTLLLEQGDFAQGTSSRSTKL
IHGGVRYLQQGNLTLVLEALRERGLLIRNAPHLVHNLSFVVPLYDWWEGPFYGIGLKLYD
VLAGKLGLGPSRLLSREETLGHIPTVEPHGLRGGVIYHDGQFDDSRLAISLALTLADLGG
VALNHFPVTGIISRDGLVAGVEARDRETGGAFRIMGRAVINAAGPFVDGVRRLADPAARD
LIAPSQGVHLVLDGSFLPGDSAIMVPHTDDGRVLFAVPWHGRTVVGTTDTPIPAAGLEPR
PLPEEIDFLLSHAARYLTRHPERRDVLSTFAGIRPLVRSDSGGDTASLSRDHTLLVEGSG
LVTIAGGKWTTYRKMGEDTVTAAAQVAGLDHRPSVTETLRIHGWQEDATEGPLQVYGSDA
AALEQLLRENAAWREPLHPALPYCAGEVVWGVRHEWARTVEDVLARRTRALLLDARAAVA
AAPRVAELMARELGRDSDWQAAQVAAFTHLARGYLPE
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcgaggatctgctgcggcatctggccgaaaccgaggtctgggacatgatcgtg
atcggcgggggcgccacgggcctcggcacggcggtggaggcggccggccgcggctaccgg
acccttctcctggaacagggggactttgcccaggggacgtccagccggagcaccaagctg
atccacggcggggtccgctacctgcagcagggaaacctgacgctggtgctggaggcgctg
cgggagcggggcctgctcatccgcaacgcaccgcacctggtccacaacctttcctttgtg
gtgccgctctacgactggtgggaagggcccttctacgggatcgggctcaagctgtacgac
gtcctggccggcaagctggggctggggccgtcccgcctgctgtcgcgggaagagaccctg
ggccacatcccgaccgtggagccccacggcctgcgcggcggggtgatctaccacgacggc
cagttcgacgactcccgcctcgcgatcagcctggccctgaccctggccgacctgggcggg
gtggcgctcaatcacttcccggtgaccggcatcatcagccgcgacggtctcgtggccggg
gtggaggcgcgggaccgggagaccggcggcgccttcaggatcatggggcgggcggtgatc
aatgccgccggacctttcgtggacggggtgcggcggctggccgacccggcggcccgggac
ctcatcgccccgagccagggggtgcacctggtgctggacggctcgtttctgcccggcgac
agcgcgatcatggttccccacaccgacgacggtcgcgtcctgttcgcggtcccctggcac
ggccggaccgtggtgggcaccaccgatacgcccatcccggcggccgggctggagccgcgc
ccgctgccggaagagatcgactttctcctgtcccatgcggcccgctacctgacccggcat
cccgagcgccgggacgtgctgagcaccttcgccggcatccggcccctggtccgcagcgac
agcggcggcgacaccgcctccctttcccgggaccacaccctgctggtggagggaagcggc
ctggtcaccattgccggcggcaagtggaccacctaccggaagatgggggaggacacggtt
accgccgctgcccaggtggccggcctggaccatcggccgtcggtcacggagacgttgcgt
atccacggctggcaggaggatgcgacggagggaccgctgcaggtctacggcagcgatgcc
gcagccctggagcaactcctgcgggaaaacgccgcctggcgtgagcccctgcacccggcg
ctcccctactgcgccggggaggtcgtctggggggtgcgtcacgagtgggcccgcacggtg
gaggatgtcctggcccgccgcaccagggcgctgctgctggatgcccgtgccgccgtggcc
gcggcgccgcgggtggcggaactgatggcgcgggagctgggacgggacagcgactggcag
gcggcgcaggttgccgcgtttacccatctggcccggggctacctgccggagtga

DBGET integrated database retrieval system