KEGG   Geobacter sulfurreducens PCA: GSU3066Help
Entry
GSU3066           CDS       T00155                                 

Gene name
ddl
Definition
(RefSeq) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
gsu  Geobacter sulfurreducens PCA
Pathway
gsu00473  D-Alanine metabolism
gsu00550  Peptidoglycan biosynthesis
gsu01100  Metabolic pathways
gsu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:gsu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    GSU3066 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    GSU3066 (ddl)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    GSU3066 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gsu01011]
    GSU3066 (ddl)
Enzymes [BR:gsu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     GSU3066 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:gsu01011]
 Precursor biosynthesis
  Amino acid ligase
   GSU3066 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 ATP-grasp_3 RimK GARS_A ATPgrasp_Ter ATP-grasp_5 ATPgrasp_ST TTL
Motif
Other DBs
NCBI-GeneID: 2686321
NCBI-ProteinID: NP_954108
UniProt: Q748D8
LinkDB All DBs
Position
complement(3371778..3372728)
Genome map
AA seq 316 aa AA seqDB search
MTRDELKTTKIGVLMGGLSAEREVSLASGGAVLKALQSRGYDAVPVDVGRDLPQVLVREW
IDVAFICLHGRYGEDGTVQGLLELMGIPYTGSGVLASALAMNKIVAKEVFAARGLTIAPY
RVVRRGETVDPVAEGFGYPVVVKPSQEGSSVGVSIVKSPEELPSALELAFRYDDDILVER
FIKGREIQIGILDDRAMGAIEIVPVNEFYDFEAKYTAGKAEHICPPVLPAELHRRLLAEG
EAAHRALGCSGYSRVDFLVTEGGECYLLEVNTLPGMTALSLLPEIALKESGIGFEDLVER
ILISAELKIKGEGAGS
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgacgagggatgagctgaaaaccacgaagataggcgtacttatgggaggactctcggct
gagcgcgaagtgtcccttgccagcggcggcgctgtgctgaaggccctccagagccgggga
tatgacgcggtccccgtggacgtcggccgggatctcccgcaggttctggtccgggagtgg
atcgatgttgcttttatctgtctccacggccgctacggggaagacggaaccgtccagggg
ctgctggagctcatgggcattccctacaccggatcgggggtcctggccagcgcccttgcc
atgaacaagatcgtcgccaaggaggttttcgccgcgcgggggctcacgatcgctccctac
cgggttgtgcgccggggcgagacagttgatcccgtggcggaagggttcggctacccggtg
gtggtgaagccgtctcaggaagggtcatcggtgggggtgagcatcgtcaagtcgccggaa
gagctcccttctgccctggagctcgccttccgctatgatgacgatatcctggtggagcgc
ttcatcaaggggcgcgagatccagatcgggatactggacgaccgggccatgggggccatc
gagatcgttcccgtgaacgagttctacgacttcgaggccaagtataccgccggcaaggcc
gagcatatctgcccaccggtactcccggcggaactgcaccgcaggctcctggccgaaggg
gaagcggctcaccgcgccctgggatgctccggttacagcagagtcgatttcctcgtaacg
gaagggggcgagtgttatctcctggaggtgaacaccctgccgggaatgaccgcgttgagc
cttctgcccgagatcgccctcaaggagtccgggatcggtttcgaggacctggtggagaga
attctgatttccgctgagctgaaaatcaagggggaaggggccggaagctag

DBGET integrated database retrieval system