KEGG   Geobacter sulfurreducens PCA: GSU3627Help
Entry
GSU3627           CDS       T00155                                 

Gene name
tpi
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gsu  Geobacter sulfurreducens PCA
Pathway
gsu00010  Glycolysis / Gluconeogenesis
gsu00051  Fructose and mannose metabolism
gsu00562  Inositol phosphate metabolism
gsu01100  Metabolic pathways
gsu01110  Biosynthesis of secondary metabolites
gsu01120  Microbial metabolism in diverse environments
gsu01130  Biosynthesis of antibiotics
gsu01200  Carbon metabolism
gsu01230  Biosynthesis of amino acids
Module
gsu_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:gsu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GSU3627 (tpi)
   00051 Fructose and mannose metabolism
    GSU3627 (tpi)
   00562 Inositol phosphate metabolism
    GSU3627 (tpi)
Enzymes [BR:gsu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     GSU3627 (tpi)
Exosome [BR:gsu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   GSU3627 (tpi)
  Exosomal proteins of bladder cancer cells
   GSU3627 (tpi)
  Exosomal proteins of melanoma cells
   GSU3627 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 13438961
NCBI-ProteinID: YP_006589502
UniProt: I7EP62
LinkDB All DBs
Position
complement(1782370..1783125)
Genome map
AA seq 251 aa AA seqDB search
MRTPVIAGNWKLFKKRAEARELVNGLVSLVKDVQGVEIVVAPVFTVLAAVKGALDGSAIK
LAGQDCFWEEEGAYTGEISPGMLVDAGCSHVIIGHSERRQYFGETDETVNRKIKAALKAG
LAAIACIGESLAEREAGTTFDVLRTQLNGGLAGLSADDLKDVIIAYEPVWAIGTGKTATD
AQAQEAHAFIRGVVSELLGKPAAEAVRILYGGSVKPENIKGLMTQPDIDGALVGGASLKA
DSFAAIASFSM
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagaacacctgtgattgcaggaaactggaagctgttcaaaaaacgcgccgaggcccgt
gagctggtcaatggacttgtttccctggtgaaggacgtccagggggtcgaaatcgtcgta
gctccggtcttcaccgtactggccgccgtaaagggcgccctggacggctcagccatcaag
ctcgctggccaggactgcttctgggaagaggaaggggcttacaccggcgagatttccccg
ggcatgctcgtggatgccggatgcagccacgtcattatcggccattcggagcgccgtcag
tatttcggcgaaactgatgaaaccgtgaatcgtaagatcaaggccgccctcaaagcagga
ctcgcggccattgcctgcatcggagaatccctggcagagcgcgaagcaggcacgacgttc
gacgtgctgcggacgcagctgaacggcggactggccgggctatccgccgacgacctcaaa
gacgtcatcatcgcctatgagccggtatgggccataggcaccggaaaaaccgccacggac
gcccaagcccaggaggctcacgccttcatcagaggggtggtgtccgaacttctcggcaaa
ccggcagcagaggcggttcgcatcctttacgggggcagcgtaaagccagagaacatcaag
gggctcatgacccaacccgatatcgacggcgccctggtgggaggagccagcctcaaggcg
gactcttttgcggcgattgcctcgttcagcatgtaa

DBGET integrated database retrieval system