KEGG   Gordonia terrae: BCM27_02190Help
Entry
BCM27_02190       CDS       T04440                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
gta  Gordonia terrae
Pathway
gta00473  D-Alanine metabolism
gta00550  Peptidoglycan biosynthesis
gta01100  Metabolic pathways
gta01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:gta00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BCM27_02190
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BCM27_02190
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BCM27_02190
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gta01011]
    BCM27_02190
Enzymes [BR:gta01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BCM27_02190
Peptidoglycan biosynthesis and degradation proteins [BR:gta01011]
 Precursor biosynthesis
  Amino acid ligase
   BCM27_02190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 GARS_A DUF4089
Motif
Other DBs
NCBI-ProteinID: ANY21779
LinkDB All DBs
Position
complement(479419..480495)
Genome map
AA seq 358 aa AA seqDB search
MSSRLLRLVVLFGGVSAEHDVSRVTAAHVLAAADRNKYDLVPIGIAKDGTWLRNDKAIAA
IADGTPLPDTLEVAGTVVDPLTELRGHADEAITVVLPLLHGPHGEDGTIQGMLELFKLPY
VGAGVLSSAVCMDKAMAKIVAEQAGIPQCRWVEFRDGVDDPETITGRAIDALGLPVFVKP
ANLGSSVGITKAHDEAELDAAVNLALRYDNVVIIEEAVTGREIEVAVLGDTAPETSVPGE
IKPGSEFYDYEDKYVTGAAQLVIPAPVSDAAAAEVRELAAKTFTAMRCSGMARVDFFYEE
SGRGWLLNEVNTIPGFTPGSMYPKLWEATGVPYPDLIDSLVTFALEVHRRRVGFSTEH
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctcggctgttgcgtctggtggtcctctttggtggagtctccgccgagcacgat
gtgtcgcgggtcacagcggcgcatgtcctggccgcggccgatcggaacaagtacgacctg
gtccccatcggcatcgccaaggacgggacctggctacgcaacgacaaggcgatcgcggcc
atcgccgacgggacgccactccccgacacgctcgaggtcgccgggaccgtcgtcgacccg
ctcaccgaactgcgcggtcacgcggacgaggccatcacggtcgtccttccgcttctgcac
ggaccgcacggcgaggacggcaccatccaggggatgctcgagctgttcaagctgccgtac
gtgggcgcgggagtgctgtcgtcggcggtctgcatggacaaggcgatggcgaagatcgtc
gccgagcaggcgggcatcccgcagtgccgctgggtcgagttccgcgacggcgtcgacgac
ccggagacgatcaccggccgggcgatcgacgccctggggcttccggtcttcgtcaaaccc
gcgaacctcggctcgtcggtcggcatcaccaaggcccacgacgaggccgaactcgacgcg
gcggtgaatctcgcgctccgctacgacaacgtggtcatcatcgaagaggccgtgaccggg
cgcgagatcgaggtcgccgttctcggcgacaccgcgcccgagacctcggtgccgggggag
atcaagccggggagcgagttctacgactacgaggacaagtacgtcaccggcgccgcccag
ctggtcatccccgccccggtgtccgacgcggcggccgccgaggttcgcgaactcgcggcg
aagacgttcaccgcgatgcgatgctccggcatggcccgcgtcgacttcttctacgaggag
tccggccgcggctggctgctcaacgaggtcaacaccatcccgggattcacccccgggtcg
atgtatcccaaactgtgggaagcgaccggcgttccctaccccgatctgatcgattcgctg
gtcaccttcgcactcgaggtgcaccgacgccgcgtggggttctccaccgagcactga

DBGET integrated database retrieval system