KEGG   Gordonia terrae: BCM27_02260Help
Entry
BCM27_02260       CDS       T04440                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
gta  Gordonia terrae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ANY25755
UniProt: A0A2I1R716
LinkDB All DBs
Position
495193..496245
Genome map
AA seq 350 aa AA seqDB search
MDLPVMPPVAPMLAKAVTSVPPQPDGSVAWSYEPKWDGFRALVFRDGDEVTIGSRGGKDL
ARYFPEIVAAVKDELPEKVVLDGEIGVPALIGDTHRLDWDSLAQRIHPAESRVTMLAEKT
PAIFIGFDALALASTSVMAEPFEVRREALLRAVGPGGRDRRVHVSRVTSDPAVAEDWFSA
FEGAGLDGVVAKRLDGVYVENKREMLKIKHKRTADCVIFGYRIHKSGTGIGSMLLGLFGD
DGELRMVGGAGAFSDAKRIELQQMFEPMRLDPEKASPGEPTRWRSEKSGEWIPIRPELVA
EFAYDQMENHRFRHTVKFLRWRPDRDPESCGYDQLEVPLTYDLHDVLEGE
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggatctcccggtcatgccgcctgtagcgccgatgctggccaaggcggtgaccagcgtg
ccgccgcaaccggacggttcggtggcgtggtcgtatgaacccaaatgggatggttttcgc
gcgttggtcttccgcgacggcgacgaggtcacgatcggatcgcgaggcggcaaggacctg
gcacggtacttccccgagatcgtcgcggcggtgaaagacgaactgcccgagaaggtggtc
ctcgacggcgagatcggggtgcccgccctcatcggcgacacccaccggttggactgggac
tcgctggcgcaacggatacatcccgccgagtcgcgcgtgaccatgctcgccgagaagacc
ccggcgatcttcatcggcttcgacgcgcttgcgctggcgtcgacgagcgtgatggccgaa
ccgttcgaagtacgacgggaggcgctgctgcgggccgtcggtccgggtgggcgggatcgt
cgcgtgcatgtcagccgggtgacgagcgaccccgcggtcgccgaggactggttctccgcc
ttcgaaggtgccgggctcgacggtgtcgtcgccaaacgactcgacggcgtgtacgtcgag
aacaagcgggagatgctgaagatcaaacacaagcgcaccgcggactgcgtgatcttcggg
tatcgaatccacaagtcggggaccgggatcggctcgatgctgctcggattgttcggtgac
gacggcgaactgcggatggtcggtggggccggcgccttctccgacgcgaaacggatcgag
ctgcagcagatgttcgagccgatgcgcctcgaccccgagaaggcgtcaccgggtgagccg
acgcgatggcggtcggagaagtcgggggagtggattccgatccgtcccgaactggtcgcg
gagttcgcctacgaccagatggagaaccaccgcttccggcacaccgtgaagttcctgcgg
tggcggcccgatcgggacccggagagctgcggctatgaccagctcgaggtccccctcacc
tacgatctccacgacgtcctcgaaggggaatga

DBGET integrated database retrieval system