KEGG   Gordonia terrae: BCM27_09055Help
Entry
BCM27_09055       CDS       T04440                                 

Definition
(GenBank) short chain dehydrogenase
Organism
gta  Gordonia terrae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short NAD_binding_4 adh_short_C2 Epimerase KR GDP_Man_Dehyd NAD_binding_10 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 Sacchrp_dh_NADP NmrA THF_DHG_CYH_C ADH_zinc_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ANY22928
UniProt: A0A4U9ZTY6
LinkDB All DBs
Position
complement(1994012..1995955)
Genome map
AA seq 647 aa AA seqDB search
MTSYFITGGSGFIGRRVLDRLLTASPDDTIHALVRESSRAAFVAMLDDLGASDRVTPVVG
DLTAPGLGIAPDAVPAIDHVIHLAAIYDMAADAESQRAANVVGTSRAADFAIAHDALFHH
VSSIAVAGDHRGRFTEMDFEVGQGFPTAYHRTKFEAERVVREREGLRWRVYRPSIVVGDS
RTGEMDKIDGPYYFFGHLGALGRLPSVLRLPMPDLGTLNIVPVDYVADAMVALIGVNPTR
SGLVFHLSDPKSLTTTEMYNALAPAFRAPRGFDAIPRSAVEPVMALSGMGIARVGRNLVA
AQQGIPGALLDAVTIPVDFRADTTVAVLHDLGITVPDFAEYAPRLWTYWSRHLDRSRNRR
TDPRGPLVGKNILITGGSSGIGKATARMCVARGANVLIVARNAEELASATEELNSTTSKK
GIPPGQVTSYQCDITDEESVNALVKTVLAAHGHVDVLVNNAGRSIRRATLNSVDRSHDYH
RVMAVNYFGAVNLVLGLLPHMVARQAGHVVNVTSVAVQSRGPRFGAYAASKAALEAFSDV
TGTETVSDHVTFSNVRLPLVKTRMIAPTEAYDNQPGTWNVDRAAARVLHAIVDRPKRVDS
LVGLVAEIGHRVTPGLTTRILHQEFLVFGESAAALGRSARDAGGQNS
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgacgagctacttcatcaccgggggcagcgggttcatcggacgacgcgttctcgaccgt
ctcctgacagcctctcccgacgacacgatccacgcactggtacgcgagtcgtcgcgcgcg
gccttcgtcgcgatgctcgacgacctcggggccagcgaccgcgtgacacccgtggtcggc
gacctgaccgcgcccgggctcggcatcgcacccgacgcggtccccgcgatcgaccatgtc
atccacctcgccgcgatctacgacatggccgccgacgcggagtcccagcgtgccgccaac
gtggtcgggacctcgcgcgccgccgacttcgcgatcgcacacgatgcgctgttccaccac
gtctcctcgatcgccgtggccggtgaccaccgtggacgcttcaccgagatggacttcgaa
gtcggacagggattcccgaccgcctatcaccgcaccaagttcgaggccgagcgcgtggtc
cgtgaacgtgagggactccgttggcgcgtctaccggccgtcgatcgtagtcggtgactcg
cgtaccggcgagatggacaagatcgacggtccctactacttcttcggccatctgggagcg
ctcgggcggttgccctcggtgctgcggctgccgatgcccgacctgggcacgctgaacatc
gtgcccgtcgactacgtcgccgacgcgatggtggcactcatcggcgtcaatcccacccgc
agcggactggtgttccatctcagcgacccgaagtcgctcacgaccaccgagatgtacaac
gcactggcaccggccttccgcgccccgcgcggtttcgacgccatcccgcggtcggcggtg
gaacccgtgatggcgttgtccggcatggggatcgcgcgtgtcggacgcaacctcgtcgcc
gctcagcaggggatccccggggcactgctcgatgcggtgacgatcccggtcgacttccgc
gccgacaccaccgtcgcggttctgcacgacctcggcatcaccgtgcccgacttcgccgaa
tacgctccgcgcctgtggacctactggtcgcgacacctcgaccggtcgcgcaaccgtcgc
accgatccgcgcgggccgctcgtcggcaagaacatcctcatcaccggagggtcgagcggg
atcggcaaggccaccgcccggatgtgtgtcgcccgcggtgccaacgtcctcatcgtcgcc
cgcaatgccgaagaactcgcctcggcgaccgaggaattgaactcgaccacgagcaagaag
ggcatcccgcccggccaggtgacctcgtaccagtgcgacatcaccgacgaggagtcggtc
aacgcgctggtcaagaccgtcctggccgcgcacggtcacgtggacgtcctggtcaacaac
gccgggcggtcgatccgtagagccaccctgaactcggtggatcggtcgcacgactaccac
cgggtgatggcggtcaactacttcggcgcggtgaacctcgtgctcggattactgccgcac
atggtcgcccggcaggcaggccatgtggtgaacgtgacgtcggtcgcggtgcagtcgcgc
gggccgcgattcggggcatacgcggcgtcgaaggccgcactggaggcgttcagcgacgtc
accggcaccgagaccgtctccgaccatgtcaccttctccaacgtccgtcttcccctggtg
aagacgcggatgatcgcgcccaccgaggcctacgacaaccagcccgggacctggaatgtg
gaccgcgccgcggcgcgcgtcctgcacgccatcgtcgaccggcccaaacgcgtcgattcg
ctcgtcgggctcgtcgccgagatcgggcaccgggtgacccccggactgaccacccgcatc
ctgcaccaggagttcctcgtgttcggcgaatcggcagcggcgctcggtcggtcggctcgt
gatgccggcgggcagaattcgtga

DBGET integrated database retrieval system