KEGG   Gordonia terrae: BCM27_10380Help
Entry
BCM27_10380       CDS       T04440                                 

Definition
(GenBank) RNA polymerase subunit sigma-24
  KO
K03088  RNA polymerase sigma-70 factor, ECF subfamily
Organism
gta  Gordonia terrae
Brite
KEGG Orthology (KO) [BR:gta00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:gta03021]
    BCM27_10380
Transcription machinery [BR:gta03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     BCM27_10380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma70_r2 Sigma70_r4_2 Sigma70_r4 TPR_2
Motif
Other DBs
NCBI-ProteinID: ANY23148
UniProt: A0A4V0A614
LinkDB All DBs
Position
complement(2298112..2299380)
Genome map
AA seq 422 aa AA seqDB search
MGSVTRRAVSGIDRDVRARVLATLTRKFGDLDLAEDAVQDAIAQALTTWPRSGVPDSPEA
WLTTTAKRKALDVVRRESVLADKLARLHAEIERAPAPAGFADPADAPPPQLPDERLGMFF
ACTHPVLRAEDRIALTLRFVAGLTTAEVAHALLIGVPTAQQRIVRAKKRIGALGVPFTPP
RDDDLPARLGGVLRVVYLMFSEGFARSSGDAHIRDDLTGEAITLARTLRSLLPRAETTGL
LALLLLTQARRPARLDGNGRPVPLGNQDRRRWDRGLTDEGIALAENAAAQPDAGPYTIQA
AIAAVHAEAPTATETDWAQIAVLYRLLEAHDPGPVVRVGRAVAVGRAYGPARGIAMLDEL
RSDPQLDRFRPFHIARALTLSELGDDVGAADAYRRALDLPGNEAEDDYLADALAGLRSGM
QM
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggggtccgtgacccgccgggcggtgtccggcatcgaccgagatgtccgcgcgcgtgta
ctcgccactctgactcggaaattcggcgacctcgacctcgcggaagacgcggttcaggac
gcgatcgcccaggcgttgaccacgtggccccggagcggcgtcccggactcgccggaggcc
tggctgacgacgacggccaaacgcaaggcactcgatgtggtgcgacgtgaatcggtcctg
gccgacaagctcgcccggttgcacgccgagatcgaacgcgccccggcacctgcgggtttc
gcggatccggccgatgcgccgccgccgcagctccccgacgagcgactcggcatgttcttc
gcctgcacccaccccgtgcttcgcgccgaggaccggatcgcgctcaccctgcggttcgtc
gccgggctgaccaccgcggaggtcgcgcacgcattgctgatcggcgttccgacggctcag
cagcgaatcgtgcgcgccaagaagcgaatcggcgcgctgggggttccgttcaccccaccg
cgcgacgacgacctccccgcccggctcggcggggttctgcgcgtggtctacctgatgttc
tccgagggattcgcccgctcgagcggcgacgcgcacatccgcgacgatctcaccggcgag
gccatcaccctcgcacgaaccctgcggtctctgctccctcgcgccgagacgaccggactg
ctcgccttgctgctcctcacccaggcccgccgtccggcgcgactcgacgggaacggaagg
ccggtaccgctgggcaaccaggatcgccgtcgctgggaccgaggtctcaccgacgagggc
atcgctctcgccgaaaatgcggccgcacaaccagatgcgggtccgtacacgatccaggcg
gcaatcgccgcggtgcacgccgaggcaccgaccgcgacggagaccgactgggcacagatc
gcggtcctgtaccggctgctcgaggcacatgatcccggtcccgtggtgcgcgtcggccgc
gctgtcgccgtgggtcgcgcctacggcccggcgcgtggcatcgcgatgctcgacgagttg
cggtcggatccacagctcgaccgcttccggccgttccacatcgcgcgggcgctcacgctc
tcggaactgggcgacgacgtcggcgcggctgacgcctaccgccgagcactcgacctgccc
ggcaacgaggccgaggacgactacctggccgatgcactggccggactccggtcgggcatg
cagatgtag

DBGET integrated database retrieval system