KEGG   Gordonia terrae: BCM27_12200Help
Entry
BCM27_12200       CDS       T04440                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
gta  Gordonia terrae
Pathway
gta00620  Pyruvate metabolism
gta00680  Methane metabolism
gta01100  Metabolic pathways
gta01120  Microbial metabolism in diverse environments
gta01200  Carbon metabolism
Module
gta_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:gta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCM27_12200
  09102 Energy metabolism
   00680 Methane metabolism
    BCM27_12200
Enzymes [BR:gta01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BCM27_12200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: ANY23455
LinkDB All DBs
Position
2686396..2689227
Genome map
AA seq 943 aa AA seqDB search
MSETAPARGVPDWRPSISIVDHIVVDDEGRALTEPLREDIRLLGGILGDVVREHSGRDVF
DLVESARVAAFRVRRNEIDRTELADMFVDLDVSTAVPVIRAFSHFALLANLAEDIHRERR
RAIHVRAGDPPQDSSLAATYRKLADAGLGDDEVGRTLSDAAVIPVITAHPTETRRRTVFE
AQNRITELMRFRGRTELMPDEDAEVTESIRRQILTLWQTALIRLERLTIQDEIRSGLRYY
DASFFEVVPAINTAVRAALRSTYPDAGLADDPMIRMGSWIGGDRDGNPFVNSDVVTLATT
LAAQAAVGHHLSELESLAQELSMSARLIDASDTLFDLAGADADDPGADEPFRLALRAIRS
RLLATARDMFDDDFLTSSEEKSIDGRQPYGDAAELLADLDVIDGALRANNDDPIADDRLL
ALREAVRTFGFHLSGLDMRQNSDTHEEVVAELLAWAGVHPDYASLEESARVEILSAELSA
RRPLTSPDAELSELATKELGIVRAAARAVATFGPAAVPNYIISMCTSVSDMLEALILLKE
AGLYDPNDGTPRCTVRVVPLFETIEDLQQGAQTLLAVLDVPFYRAMVDSQNGIQEIMLGY
SDSNKDGGYMAANWALYRAELDLVDAASQSGIRLRLFHGRGGTVGRGGGPSYDAILAQPP
GAVQGSLRITEQGEIIAAKYAEPVAARRNLETLLAATIESSLLDTEGLGDESDSAYEIMD
DIAAKARAAYSRLVHETPGFVEYFTTSTPLSEIGALNIGSRPASRKQTEKISDLRAIPWV
LSWTQSRVMLPGWYGTGSAFEEWVADDPDRLETLRRYYAKWPFFRTVMSNMAQVLAKSDM
GLAHRYAQLVPDEELRDKVFGMIVDEHERTIAMCAKITGTDDLLHDNAALKRSVYNRFPY
LEPLNLLQVELLRRFRAGEDTPIVRRGIQLTMNGLATALRNSG
NT seq 2832 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaaccgcccccgcacggggagtcccggactggcgcccatccatctccatcgtc
gaccacatcgtcgtcgacgacgagggccgggcactcaccgaaccgctgcgcgaggacatt
cgtctcctcggcggaatcctcggcgacgtcgtccgagaacattcgggacgcgacgtgttc
gatctcgtcgaatccgcccgtgtggccgcgttccgcgtgcgccgcaacgagatcgaccgg
accgagctcgccgacatgttcgtcgatctcgacgtctccactgccgtcccggtcatccgg
gcgttcagtcacttcgcgttgctggccaatctggccgaggacatccaccgcgagcggcgc
cgggccattcacgtccgagccggcgatccgccccaggacagcagtctcgccgccacctac
cgcaaactcgccgatgccggtctcggcgacgacgaggtcggtcggaccctgtccgacgcc
gcggtgatcccggtcatcaccgcacaccccaccgagactcgccgccgcaccgtcttcgag
gcccagaaccgcatcaccgagctgatgcgattccgcggccgcaccgagctgatgccggac
gaggacgcggaggtcaccgagtccatccggcgtcagatcctgacgctctggcagaccgcc
ctcatccgcctcgaacgtctcaccatccaggacgagatccgttcgggtctgcggtattac
gacgcgtcgttcttcgaggtcgtgccggcgatcaacaccgcggtgcgcgccgcgctgcgc
tcgacataccccgatgccgggctcgccgacgatccgatgatccgaatggggtcgtggatc
ggcggcgaccgcgacggcaatccgttcgtgaactccgacgtggtgaccctggccacgacc
ctcgcggcgcaggccgccgtcggacaccacctgtccgaactcgagagtctcgcacaggaa
ctcagcatgtcggcccggctcatcgacgccagcgacaccctgttcgacctcgccggggcc
gacgccgacgacccgggggccgacgaacccttccgactcgctctgcgcgccatccgctcc
cgtctgctggcgaccgcgcgggacatgttcgacgacgacttcctcacctccagcgaggag
aagtcgatcgatgggcgacaaccgtacggcgacgcggccgaactgctcgccgacctcgat
gtgatcgacggcgcactccgcgccaacaacgacgacccgatcgccgacgatcggctgctc
gcactccgggaagccgtgcgcaccttcggcttccacctgtccgggctggacatgcggcag
aactccgacacgcacgaggaagtggtcgccgagctgctcgcgtgggcgggggtgcacccg
gactacgcgtcgctcgaggagtccgcgcgagtggagatcctctcggccgagctgagcgcg
cgtcgtccgttgaccagccccgacgccgaactcagcgagctcgcgaccaaggagctcggt
atcgtccgggccgccgcccgagcggttgcgaccttcgggccggcggcggtgcccaactac
atcatcagcatgtgcacctcggtgagtgacatgctcgaggcgctgatcctcctcaaggag
gccggcctctacgacccaaatgacggtacgccgcggtgtacggttcgggtggtcccgctc
ttcgagaccatcgaggatctccagcagggtgcgcagacactgctcgcggtcctcgacgtc
ccgttctaccgagcgatggtggactcccaaaacgggatccaagagatcatgctcggttac
tccgattccaacaaggacggcggctacatggccgccaactgggcgctctaccgtgccgaa
ctcgatctggtcgacgcggcctcgcagtcggggattcggttgcggctgttccacggacgc
gggggcaccgtcggccgtggcggcggtcccagctacgacgccatcctggcccaaccgccg
ggcgcagtccagggctcgctgcgcatcaccgagcagggtgagatcatcgccgcgaaatac
gccgagccggtcgcggcgcggcgcaatctcgagaccctgctcgccgcgaccatcgagtcc
tcgctcctggacaccgagggcctcggtgacgagtccgactcggcctacgagatcatggac
gacatcgcggcgaaggcccgcgccgcctacagccgcctggtgcacgagacaccgggtttc
gtcgagtacttcaccacctcgacgccgctgtcggagatcggcgcgctcaacatcggcagc
cgtccggcgtcgcgcaagcagaccgagaagatctccgatctgcgcgcgatcccgtgggtc
ctgtcgtggacgcagtcacgcgtgatgctgcctggttggtacggcacggggtcggcgttc
gaggaatgggtcgccgacgacccggaccgcctggagaccctgcgccgctactacgcgaag
tggccgttcttccggaccgtcatgtcgaacatggcccaggtgctggcgaagtcggacatg
ggtctggcgcaccggtacgcgcagctcgtccccgacgaggagttgcgcgacaaggtgttc
ggcatgatcgtcgacgaacacgaacgcacgatagcgatgtgcgcgaagatcaccggcacc
gacgacctgctccacgacaacgccgccctcaagcggtccgtgtacaacaggtttccgtac
ctcgaaccgctgaacctgctgcaggtcgagttgctccgccgcttccgggcgggggaggac
acccccatcgtccgacgcggaatccagctcacgatgaacggtctcgcgaccgcgctacgg
aactcgggctag

DBGET integrated database retrieval system