KEGG   Gordonia terrae: BCM27_13325Help
Entry
BCM27_13325       CDS       T04440                                 

Definition
(GenBank) nucleoside-diphosphate sugar epimerase
Organism
gta  Gordonia terrae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_10 NmrA Epimerase 3Beta_HSD GDP_Man_Dehyd RmlD_sub_bind adh_short PAC2 TrkA_N NAD_binding_4
Motif
Other DBs
NCBI-ProteinID: ANY23647
UniProt: A0A4V0AGX9
LinkDB All DBs
Position
complement(2960927..2962261)
Genome map
AA seq 444 aa AA seqDB search
MDESRTCLVTGATGYVGGRLAPRLLARGHSVRALARTPDKLSGAPWLSDPGAEVVEGDLS
DRDSLVKAFAGVDVVYHLVHSMSTDADFAAEERRAAENVVAAAQQNGVARIVYLGGLHPT
GTDLSEHLASRAEVGDILIDSPIETVALQAGTLIGSGSASFELIRHLTERLPAMTTPRWV
HNKIQPIAVDDALHYLVEAATAMVPSSRTWDIGGPDVLEYGDMMQVYAEVAGLRPRIMVV
LPYLTPALASRWVRFVTPIRGKIARPLIESLECDAVCRDRAVDAIIDRPEGGLTPYSEAV
ARTLERSARGDGRASWANASADVSPAEPLPTDPDWAGEEIFERVTRTSERASTTTVWDRL
EREARHRGEIALARRPDLLRVRLRDNRFGRSYREHQIDDAAGTAGVVEITTTERFFPRGL
AGLAFWRLGRPFRALGIPGADPLR
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
gtggacgagtcgcgaacctgtctggtcaccggagcaaccggctacgtcggaggtcggttg
gcgccgcggttgctggcacgcggacacagcgtccgcgcgctggcgcggacgccggacaag
ctgtccggtgcaccgtggctgtccgatccgggtgccgaggtggtcgaaggcgacctctcc
gaccgtgactcactggtgaaggcgttcgccggagtcgacgtcgtctaccacctggtgcat
tcgatgagcaccgacgccgacttcgccgcggaggagcggcgcgctgcggagaacgtggtc
gcggcggcccagcagaacggggtcgcccggatcgtgtatctgggtggcctgcaccccacc
ggcaccgatctctccgaacatctcgcgtcccgagccgaggtcggtgacatcctgatcgac
tcgccgatcgagaccgtcgcattgcaggcgggcacgctgatcggctcgggatcggcgtcg
ttcgaactcatccggcacctcaccgagcgcttgcccgcgatgaccactcctcgatgggtc
cacaacaagatccagccgatcgcggtcgacgatgcgctgcactacctcgtcgaggcggcc
accgccatggtcccgtcatcacgaacgtgggacatcggtggaccggacgtcctggagtac
ggcgacatgatgcaggtgtatgccgaggtcgccggcctccgtccccggatcatggtggtg
cttccctatctcactccggcactggccagtcgatgggtccggttcgtcacccccattcgc
ggcaagatcgcacggccgctgatcgaatctctcgaatgcgacgccgtgtgtcgcgaccgg
gcggtcgacgcgatcatcgatcggccggagggcggcctgaccccctactcggaggcggtg
gcccgcaccctcgagcggtctgcgcgcggtgacggccgggcctcgtgggccaatgcctcc
gccgacgtgtctccggccgaaccccttcccaccgacccggactgggccggtgaggagatc
ttcgagcgggtcacccgcaccagcgagcgcgcgagcaccacgacggtctgggaccggctc
gaacgggaggcgcggcaccgaggcgagatcgcgctcgcccgacgtcccgatcttcttcga
gtacgactccgcgacaaccgattcggcagatcgtatcgagagcatcagatcgatgatgcg
gctgggacggccggcgtcgtggagatcacgaccacggagcggttctttccacgcggtctc
gccggcctcgcgttctggcgtctcggccgacctttccgggcactcggcatccccggcgct
gatccacttcggtga

DBGET integrated database retrieval system