KEGG   Gordonia terrae: BCM27_16705Help
Entry
BCM27_16705       CDS       T04440                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
gta  Gordonia terrae
Pathway
gta00010  Glycolysis / Gluconeogenesis
gta00030  Pentose phosphate pathway
gta00051  Fructose and mannose metabolism
gta00052  Galactose metabolism
gta00680  Methane metabolism
gta01100  Metabolic pathways
gta01110  Biosynthesis of secondary metabolites
gta01120  Microbial metabolism in diverse environments
gta01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:gta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCM27_16705
   00030 Pentose phosphate pathway
    BCM27_16705
   00051 Fructose and mannose metabolism
    BCM27_16705
   00052 Galactose metabolism
    BCM27_16705
  09102 Energy metabolism
   00680 Methane metabolism
    BCM27_16705
Enzymes [BR:gta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BCM27_16705
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     BCM27_16705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ANY24215
LinkDB All DBs
Position
complement(3722684..3723718)
Genome map
AA seq 344 aa AA seqDB search
MAKRFGILTSGGDCPGLNAVIRGAVLKGETVYGHEFVGFRDGWAGLVYGDIVELNRSTVR
GLSNQGGTILGTSRFGPYSEPDGGPENIKKVLKNLEIDGVIAIGGEGTAAASKRLFDDGI
NIVGVPKTIDNDIAATDYTFGFNTAVEIATEAIDRLRTTGNSHKRCMVLEVMGRHAGWIA
LHSGIAGGAHVILIPENPESLDQICAWVTSVKSRGRSPMVVVAEGFTLPEMTEAHSTKGL
DGFNRPRLGGVAEVLAPLIEERTGIETRATILGHIQRGGVPSAYDRVLATRMGMATADLV
AEKGWGQMVALHGTEIARITFDEALGELKTVPLDQYKEIRVIFG
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaggttcggcattctgacgtccgggggagactgccccggactgaacgcggtg
atccgtggcgcagtgctcaaaggtgagaccgtctacggccacgagttcgtcggcttccgg
gacggctgggccggactcgtctacggcgacatcgtcgaactcaaccggtcgacggtccgc
ggcctgtccaaccagggcggcaccatcctgggcacgagccggttcggtccctactccgag
cccgacggcggacccgagaacatcaagaaagtgctgaaaaatctcgagatcgacggcgtg
atcgcgatcggcggcgagggcaccgccgcggcgtcgaagagactgttcgacgacggcatc
aacatcgtcggggttcccaagaccatcgacaacgacatcgcggcgaccgattacaccttc
ggcttcaacaccgcggtggagatcgcgaccgaggccatcgaccggctccgcaccaccggc
aactcgcacaagcggtgcatggtgctcgaggtgatgggccgccacgccggctggatcgcc
ctgcactcggggatcgcgggcggcgcccacgtcatcctcatcccggagaaccccgagagc
ctcgaccagatctgtgcctgggtcaccagcgtcaagtcgcgtggccggtcgccgatggtc
gtcgtcgccgaggggttcacactcccggagatgacggaggcccactcgaccaagggtctc
gacggcttcaaccgaccccggctcggcggcgtggccgaggtgctcgcgccgctcatcgag
gagcggaccggcatcgagacccgggccaccatcctcggtcacatccagcgcggcggggtg
ccgtcggcctatgaccgggtgctggcgacacgcatgggcatggcgaccgccgacctcgtc
gccgagaagggctgggggcagatggtcgccctgcacggcaccgagatcgcgcgcatcacc
ttcgacgaggcgctcggcgagctcaagaccgtgccgctggaccagtacaaggagatccgg
gtcatcttcggctga

DBGET integrated database retrieval system