KEGG   Gordonia terrae: BCM27_19780Help
Entry
BCM27_19780       CDS       T04440                                 

Definition
(GenBank) epimerase
  KO
K00091  dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
gta  Gordonia terrae
Brite
KEGG Orthology (KO) [BR:gta00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BCM27_19780
Enzymes [BR:gta01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydroflavonol 4-reductase
     BCM27_19780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase 3Beta_HSD NAD_binding_10 GDP_Man_Dehyd NAD_binding_4 NmrA Polysacc_synt_2 KR RmlD_sub_bind TrkA_N NAD_binding_2 NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ANY24743
UniProt: A0A4V0B0S7
LinkDB All DBs
Position
4455510..4456505
Genome map
AA seq 331 aa AA seqDB search
MPSLVIGGNGFLGSRLVRRLIDSGDDVRVLTRSTSDLRSLIGLDVEHVTGDLFDDASLER
AMRGCEVVFHCAVDTRAWLRDATPLYRTNVDALRSVLDVAARQSLRRFVFTSSIATIGRV
RGRPATEADRFNWSRQAPEYVKSRVAAENLVLERARDGAVPAVAMCVANTYGPGDWQPTP
HGAFVAGAALGKLPFSIRGCRAESVGIDDAASALHLAADHGEVGERYIVSERAIDTGEVV
SIAAATADRPPPRLVLNRAALYACGAAGSARAVLTRKPVQLTIPSVRLMHFMSEMDHGKA
ERDLGWHPRPVTQAIADGARFWLERRAARHP
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
gtgccgtcactcgtcatcggcggcaacggattcctcggctcccgcctcgtgcgccgactg
atcgactccggcgacgacgtccgcgttctgacccgctcgacgagtgacctccgatcgctc
atcgggctcgacgtcgagcacgtcaccggcgatctgttcgacgacgcatccctcgagcga
gccatgcgcggttgcgaagtggtgttccactgcgccgtcgacacccgcgcatggttgcgc
gatgccactccgctctaccgcacgaacgtcgatgcgctgcggtcggtgctggacgtcgcc
gcccggcagtcgttgcgcaggttcgtgttcaccagcagtatcgccaccatcggtcgggtt
cggggtcgcccggcgaccgaagccgatcggttcaactggtcgcgacaggcacccgaatac
gtgaagagtcgcgtggcggccgagaacctggtgctggagcgggcccgggacggcgccgtg
cccgcggtcgccatgtgcgtcgccaacacctacggccctggcgactggcagcccacacca
cacggagcattcgtcgccggtgcggcactcggcaagctgccgttcagcattcgcgggtgc
cgcgccgagtccgtcggcatcgacgacgcggcgtcggcgctccacctcgcggccgatcat
ggcgaggtgggcgaacgctacatcgtctccgagcgcgcgatcgacaccggcgaggtcgtg
tcgatcgcggcggcaacggcagatcgcccgcccccacgactggtgctgaacagggccgcg
ctctatgcctgcggcgcggcgggttccgcgcgggccgtgctgacccggaagccggtgcag
ttgacgatcccctcggtccggttgatgcatttcatgtccgagatggatcacggcaaggcc
gagcgtgacctcggttggcatccgcgcccggtgacccaggccatcgccgacggcgcccgc
ttctggctcgagcgccgcgccgcgcgccacccctga

DBGET integrated database retrieval system