KEGG   Gordonia terrae: BCM27_21045Help
Entry
BCM27_21045       CDS       T04440                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
gta  Gordonia terrae
Pathway
gta00250  Alanine, aspartate and glutamate metabolism
gta00410  beta-Alanine metabolism
gta00640  Propanoate metabolism
gta00650  Butanoate metabolism
gta01100  Metabolic pathways
gta01120  Microbial metabolism in diverse environments
Module
gta_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:gta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BCM27_21045
   00650 Butanoate metabolism
    BCM27_21045
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BCM27_21045
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BCM27_21045
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:gta01007]
    BCM27_21045
Enzymes [BR:gta01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BCM27_21045
Amino acid related enzymes [BR:gta01007]
 Aminotransferase (transaminase)
  Class III
   BCM27_21045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ANY24962
LinkDB All DBs
Position
4748383..4749696
Genome map
AA seq 437 aa AA seqDB search
MTASVDSPIRSGQTASLSPALKQATPVVVDTAAGSWIRGTDGRDYLDFTTGIGVTSTGHC
HPHVVAAAQAQCAKVIHAQYTTVMHTPLLELTARLGSVLPAGLDSVFYANSGSEAVEAAV
RLARMATAKPNIIVFQGGFHGRTVAAASLTTAGTRFSAGFSPLMSGVHMAPFPYAYRYGW
DTDTAVDFALRELDYLLQSRVAPNDTAAFLIEPVLGDGGYLPTPPRFLQGLRDRADRHGI
LLVLDEVQAGFGRTGKFWGHQHAAGLTPDILITAKGLASGFPISAIAAPRELMSKAWPGS
QGGTYGGNAVAAAAAIATLDVIESEGLVENARVRGEQLLAGLRQVCAAFPGVGDVRGLGL
MAGIEFITTDAAGNTAPDAAAALAVQQATTAQGLLSLTCGPAANVVRLIPALVVTAEEID
LGVARFGAALAAALGQN
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccagtgttgactccccgatccgctccggccagaccgcgtcgctgagcccggcg
ctgaagcaggcgacccccgtggtcgtcgacaccgcggctggctcgtggataaggggcacc
gacggtcgcgactatctcgacttcaccaccggtatcggtgtgaccagcaccggacactgc
cacccgcacgtcgtcgcggccgcgcaggcacagtgcgccaaggtcatccacgcgcagtac
accaccgtgatgcacaccccgctcctcgagctcaccgcgcgcctcgggtcggtactgccc
gccggactcgactccgtcttctatgcgaactccggttccgaggccgtcgaagccgctgtc
cgcctggcgcggatggccaccgcgaaacccaacatcatcgtgttccagggtggtttccac
ggccgtaccgtcgcggcggccagcctgacgaccgccgggacgcgtttctccgcaggcttc
tccccgctgatgagcggcgtgcacatggcaccgttcccgtacgcctaccgctacggctgg
gacaccgacaccgccgtcgatttcgcgctgcgcgagctcgactatctgctgcagtcgcgg
gtcgcgcccaatgacacggccgccttcctcatcgaaccggttctcggcgacggtggatac
ctgcccaccccgccgcgcttcctccagggtctgcgggatcgcgccgaccgccatggcatc
ctcctcgtcctcgacgaggtgcaggcgggattcggccgcaccggcaagttctggggtcac
cagcacgcggcgggcctgacccccgacatcctgatcaccgccaagggcctggcatcggga
ttcccgatctcggcgatcgcggcaccgagggagttgatgagcaaggcctggcccggctcg
cagggtggtacgtacgggggcaacgccgtggcggcggccgccgcgatcgccacgctcgac
gtgatcgagtccgagggcctcgtcgagaacgcccgcgtgcgcggtgaacagttgctcgcc
ggcctgcggcaggtgtgcgccgccttccccggcgtcggggacgtccgcggcctgggactg
atggccggcatcgagttcatcaccaccgacgccgccgggaacaccgcgcccgacgcggcg
gccgcgctcgccgtgcagcaggccaccaccgcccaggggttgctctcgctcacgtgcggt
ccggcggccaacgtcgtgagactcattcccgccctcgtggtcacggccgaggagatcgat
ctcggtgtcgcccgtttcggcgccgcactcgccgcggcgctcggccagaactga

DBGET integrated database retrieval system