KEGG   Gordonia terrae: BCM27_21650Help
Entry
BCM27_21650       CDS       T04440                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
gta  Gordonia terrae
Pathway
gta00071  Fatty acid degradation
gta00280  Valine, leucine and isoleucine degradation
gta00281  Geraniol degradation
gta00310  Lysine degradation
gta00360  Phenylalanine metabolism
gta00362  Benzoate degradation
gta00380  Tryptophan metabolism
gta00410  beta-Alanine metabolism
gta00627  Aminobenzoate degradation
gta00640  Propanoate metabolism
gta00650  Butanoate metabolism
gta00903  Limonene and pinene degradation
gta00930  Caprolactam degradation
gta01100  Metabolic pathways
gta01110  Biosynthesis of secondary metabolites
gta01120  Microbial metabolism in diverse environments
gta01130  Biosynthesis of antibiotics
gta01212  Fatty acid metabolism
Module
gta_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:gta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BCM27_21650
   00650 Butanoate metabolism
    BCM27_21650
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BCM27_21650
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BCM27_21650
   00310 Lysine degradation
    BCM27_21650
   00360 Phenylalanine metabolism
    BCM27_21650
   00380 Tryptophan metabolism
    BCM27_21650
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BCM27_21650
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BCM27_21650
   00281 Geraniol degradation
    BCM27_21650
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCM27_21650
   00627 Aminobenzoate degradation
    BCM27_21650
   00930 Caprolactam degradation
    BCM27_21650
Enzymes [BR:gta01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BCM27_21650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 SDH_sah Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: ANY25068
UniProt: A0A2I1RA00
LinkDB All DBs
Position
complement(4896790..4897566)
Genome map
AA seq 258 aa AA seqDB search
MTEHQTIVVETSGRVGIITLNRPKALNALNTELMNEVVGAVREFDVDQGIGAIVITGSEK
AFAAGADIKEMSSKSYADVVNEQFFGAWDELSRARTPIIAAVTGYALGGGCELAMLCDTI
IAGDNAVFGQPEINLGVIPGIGGSQRLTRAVGKAKAMDMVLTGRQMKVDEAERLGLVSRV
VPKEDCRAAAIEVAEVIASKSLIASAAAKDAVNRAFESSLVEGVRAERALFYSTFATDDQ
TEGMAAFVEKRDPNFTHR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacaccagaccatcgtcgtcgagaccagcggccgggtgggcattatcaccctc
aaccgcccgaaggcgctgaacgctctcaacaccgagctgatgaacgaagtggtcggcgct
gtccgcgaattcgacgtcgaccaggggatcggcgcgatcgtgatcaccggttcggagaag
gcgttcgccgcgggcgccgacatcaaggagatgtcgtcgaagtcgtacgcggacgtggtg
aacgagcagttcttcggcgcctgggatgagctgtcgcgggcgcgcaccccgatcatcgcc
gcggtcaccggttacgcactcggcggcggctgcgagctcgcgatgctgtgcgacaccatc
atcgccggcgacaacgccgtcttcggccagcccgagatcaacctgggtgtcatccccggc
atcggcggctcgcagcgtctcactcgcgccgtcggcaaggccaaggcgatggacatggtg
ctgaccggccggcagatgaaggtcgacgaggccgaacgcctcggcctcgtgtcgcgggtc
gttcccaaggaggactgccgcgccgccgccatcgaggtcgccgaggtcatcgcctcgaag
tcgctcatcgcgtccgcggccgccaaggacgcggtcaaccgcgcctttgagtcgagcctg
gtcgaaggcgtccgcgccgaacgcgcgctgttctactcgacgttcgcgaccgacgaccag
accgagggcatggccgccttcgtcgagaagcgggacccgaacttcacccaccgctga

DBGET integrated database retrieval system