KEGG   Gordonia terrae: BCM27_22450Help
Entry
BCM27_22450       CDS       T04440                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
gta  Gordonia terrae
Pathway
gta00220  Arginine biosynthesis
gta00250  Alanine, aspartate and glutamate metabolism
gta00290  Valine, leucine and isoleucine biosynthesis
gta01100  Metabolic pathways
gta01110  Biosynthesis of secondary metabolites
gta01130  Biosynthesis of antibiotics
gta01210  2-Oxocarboxylic acid metabolism
gta01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gta00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BCM27_22450
   00290 Valine, leucine and isoleucine biosynthesis
    BCM27_22450
   00220 Arginine biosynthesis
    BCM27_22450
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:gta01007]
    BCM27_22450
Enzymes [BR:gta01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     BCM27_22450
    2.6.1.66  valine---pyruvate transaminase
     BCM27_22450
Amino acid related enzymes [BR:gta01007]
 Aminotransferase (transaminase)
  Class I
   BCM27_22450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ANY25208
LinkDB All DBs
Position
5067659..5068912
Genome map
AA seq 417 aa AA seqDB search
MSRPHVSHLNQNLKPLEQSLKLQNVCYEIRGPVHAHAQRLEAEGHRILKLNIGNPALFGF
EAPDVIMRDMIHALPYAQGYSESAGVLSARRAVVTRYELIPDFPYFDVDDVILGNGVSEL
ITMTMQALLNDGDEVLIPAPDYPLWTAMTSLSGGQPVHYRCDEENGWNPDVADIAAKITD
RTKAIVIINPNNPTGAVYSREVLEQLVELAREHSLLILADEIYDKIIYDDAEHVNVASLA
PDLLCLTFNGLSKAYRVCGYRAGWVVMTGPKDHARGFIEGMGILASTRLCANVPGQHAIQ
VALGGYQSIEALVSPGGRLYEQRNVTWEKLNEIPGVSCVKPKGALYAFPRLDPEIYEIHN
DELFVQDLLLQEKILVVQGTGFNLDDHNHFRIVTLPWSRDLTEAVERIGNFLSSYRQ
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaggccccatgtttcgcacctcaaccagaacctcaagccgctcgagcagtcgctc
aagctgcagaacgtgtgctacgagatccgtggacccgtccatgcgcacgcgcagcggctc
gaggcggagggccatcgaatcctcaagctgaacatcggcaacccggcgctgttcggtttc
gaggcccccgacgtgatcatgcgcgacatgatccacgccctcccctacgcgcagggctac
tccgagtccgccggcgtcctgtccgcacgccgtgccgtggtgacccgctacgagctcatc
cccgacttcccgtacttcgacgtcgacgacgtcatcctgggcaacggcgtctccgagctc
atcaccatgacgatgcaggcgctgctcaacgacggcgacgaggtcctgatcccggcaccc
gactacccgctgtggaccgcgatgacctcgctgtccggcgggcagcccgtgcactaccgc
tgcgacgaggagaacgggtggaaccccgacgtcgccgacatcgccgcgaagatcaccgac
cgcaccaaggcgatcgtcatcatcaacccgaacaatccgaccggggcggtctactcacgc
gaggtcctcgagcaactcgtcgaactcgcccgcgagcactcgctcctcatcctcgccgac
gagatctacgacaagatcatctacgacgacgccgagcacgtgaacgtggcctcgttggcg
ccggatctgttgtgcctcaccttcaacggcctgtcgaaggcctaccgcgtctgcggctac
cgcgccgggtgggtcgtgatgaccggacccaaggaccacgcgcgcgggttcatcgagggc
atgggcatcctggcttcgacgcgcctgtgcgccaacgtgccgggccagcacgcgatccag
gtggcgctcggcggttaccagtccatcgaggcgctcgtctcccccggcggccggctgtac
gaacagcgcaacgtcacctgggaaaagctgaacgagatccccggggtcagctgcgtcaaa
cccaagggcgcgctgtacgccttcccgcgcctcgatcccgagatctacgagatccacaac
gacgaactgttcgtccaggacctgctgctgcaggagaagatcctcgtcgtccaggggacg
gggttcaacctcgacgaccacaatcacttccgcatcgtcacgctgccgtggtcccgggat
ctgaccgaggccgtggagcgtatcggcaacttcctgtcgtcgtatcggcagtga

DBGET integrated database retrieval system