KEGG   Gordonia terrae: BCM27_22735Help
Entry
BCM27_22735       CDS       T04440                                 

Definition
(GenBank) glycine oxidase ThiO
  KO
K03153  glycine oxidase [EC:1.4.3.19]
Organism
gta  Gordonia terrae
Pathway
gta00730  Thiamine metabolism
gta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gta00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BCM27_22735
Enzymes [BR:gta01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.19  glycine oxidase
     BCM27_22735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_2 Pyr_redox_2 NAD_binding_8 Pyr_redox HI0933_like 3HCDH_N DUF4232 Pyr_redox_3 AlaDh_PNT_C GIDA FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: ANY26297
LinkDB All DBs
Position
complement(5131119..5132183)
Genome map
AA seq 354 aa AA seqDB search
MNSPQQKPAHRPLTVVGGGVIGLTCALAAADAGWRVRVLDAGTEERASWVAGGMLGSLGE
GIPGEEASLALSVESVRRWPALVKRLDDPAVVTATDSLFVAASATDIEYLRHLADFVWSG
QPGTDAALQPVTGRDIRTLEPSLSSRLVGGYRAIGEWSVDNRRLLEALRAAATSAGVELV
SARLESLSDVDDLGPDAQVLLAAGLGTAALWPDVDLHPAKGEILRLRRTRWSVPPPDHVV
RARLHGRAVYVVPREDGVVVGATQYEAAGMADRTPQAGGVADLLADAIEVMPGLRTYELT
EAAAGLRPCTADGLPLVTRVDARTVVATGHGRNGIVLAPGTAERVLSILEGVEE
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
gtgaattcccctcagcagaagcctgcgcaccgcccgctcacggtcgtgggcggcggcgtc
atcgggttgacgtgcgcgctcgccgcggccgacgccgggtggcgggttcgcgtactcgac
gccggcaccgaggagcgcgcctcgtgggtcgcgggcggcatgctcggttcgctcggcgag
gggatccccggcgaggaggcatcgctcgccctgtcggtcgagtcggtccgccgctggcct
gcgctcgtgaaacgactcgacgatccggccgtcgtcaccgccaccgactcgctcttcgtc
gcggcctcggccaccgacatcgagtatctgcggcacctcgccgacttcgtctggtccggt
cagcccggcactgatgccgcgctgcagccggtgaccggccgcgacatccgaacactggaa
ccgtcactgagttcgcgactcgtcggtggctaccgcgcgatcggggaatggtcggtggac
aaccgtcgactgctcgaggctctgcgcgccgcggccaccagtgccggcgtggaactcgtc
tccgctcgcctcgagtccctgtccgatgtcgacgacctgggccctgacgcgcaggtcctg
ctcgccgccggactcggcaccgcggcactgtggccggacgtcgacctgcacccggccaag
ggggagatcctgcggcttcgtcgcacgcggtggtccgtgcccccgcccgaccacgtcgtc
cgggctcgcctgcacggccgcgccgtgtacgtggtcccgcgcgaggacggggtcgtcgtc
ggggccacccagtacgaggcggcggggatggccgaccggacgccgcaggccggtggggtc
gccgacctgctggccgacgcgatcgaggtgatgcccgggctgcggacgtatgagctgacc
gaagcggcggccggcctgcggccgtgcaccgccgacgggttgccgctcgtcacccgcgtg
gacgcccgcacggtcgtggcgaccgggcacggacgcaatgggatcgtcctcgctcccggt
accgcggagcgggtcctgtcgatcctggaaggagtcgaggaatga

DBGET integrated database retrieval system