KEGG   Gordonia terrae: BCM27_23555Help
Entry
BCM27_23555       CDS       T04440                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
gta  Gordonia terrae
Pathway
gta03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:gta00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    BCM27_23555
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:gta03400]
    BCM27_23555
Enzymes [BR:gta01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BCM27_23555
DNA repair and recombination proteins [BR:gta03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     BCM27_23555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase Prim-Pol DNA_primase_S DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: ANY26326
UniProt: A0A4V0B5U0
LinkDB All DBs
Position
5312365..5314740
Genome map
AA seq 791 aa AA seqDB search
MAGGESLEVDGRRISITNLSKVLYPASGTRKFEVIDYYSRIADVLLPHIRNRLITRKRWP
SGVESTPFFEKNVPDSAPDWIRRHGIQHSERVISYAMADDRATLVWLAQMAVLEIHTPQW
RLPMGPDGAPMANRIVFDLDPGPRVPLHRTAEVACEIRNWLGGTTTYPVTSGGKGIHLYA
RLPKPVTSDAARKVAQEVANEFARQHSDFITAKMSKSLRDDKVFIDWSQNTAAKTTLAPY
SMRGREQPWVAAPRTWEEIEDPGLSQLLYTEVLDRVEEFGDLLDGLDDPYDDEPAATVEQ
AQSAGQVINLKEYRRKRDQSKTPEPFGDEVHRQRIEAESLPEVTDSAESTTDRAPIFVIQ
EHHARRLHYDFRLEHDGVLVSWAVPKNLPTDPDQNRLAVQTEDHPMDYADFEGDIPAGEY
GGGHVSIWDKGTFELEKWRDKEVIVRLHGERAQGRYALIRTGEKNWLAHLMSDEPRPIVP
DSLTDPRPMLATDESIDGLNGRDWAFEGKWDGYRLLIRSVGGEFRLTSRSGIDMTADFPE
LAGLADDLGLMDVVLDGEVVAIDSSGRTNFTLLTSRRHTDEPYSLRLHLFDILFLNGSSL
LRKPWSVRRELLEELAPAFRNSAFVEVPPLLPGPGSAAVEYSREHNLEGVVAKRRNSVYQ
QGRRSTTWLKHKNWSDIEVVVGGFRPGRGNRSHTIGSLLIGLPEETGLRYVGRVGTGFTD
AQLRSLAEELGPLEISRSPFLDKLDRPVASSAVWVLPKIVGEVRFMDWTTAGHLRHPSWR
GIRRDKLPGDL
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcggcgagtctctggaggtcgacggccgccggatctcgatcaccaatctctcg
aaggtgctctatccggcgtcgggaacccgcaagttcgaggtcatcgactactactcgcgt
atcgccgacgtcctgctcccccacatccgcaatcgcctcatcacccgcaaacggtggccc
agcggcgtcgaatcgacgccgttcttcgagaagaatgtccccgacagcgcaccggactgg
attcgacgccacggcatccagcacagcgagcgggtcatctcctatgcgatggccgacgat
cgcgccacgctggtctggctcgcccagatggcggtgctcgagatccacacaccgcagtgg
cggctacccatggggcccgacggcgcgcccatggccaaccgcatcgtcttcgacctcgat
cccggtccacgggtgccgctgcaccggaccgcagaggtggcgtgcgagatccgcaactgg
ctcggcgggacgacgacgtacccggtgaccagcggcggcaagggcatccacctctatgcg
cggctcccgaagcccgtgacgtcggatgcggcgcgcaaggtggctcaggaggtcgccaac
gagttcgcccgtcagcacagcgatttcatcaccgccaagatgtccaaatcgctgcgcgac
gacaaggtcttcatcgactggagccagaacaccgccgccaagaccactctcgcgccatac
tcgatgcgcggacgcgagcagccgtgggtggccgcgccgcgcacctgggaggagatcgag
gaccccggactctcccaactgctctacaccgaggtgctggaccgcgtcgaggagttcggc
gatcttctcgacggtctcgacgacccctacgacgacgagccggcggccaccgtcgagcag
gcgcagtcggccggccaggtcatcaatctgaaggaataccgtcgcaaacgcgaccagtcg
aagacgcccgagcccttcggtgacgaggtgcaccggcagcgcatcgaagccgaaagcctc
ccggaagtaaccgactccgctgaatcgacgacggaccgggcgccgatcttcgtgatccag
gaacatcacgcccggcgattgcactacgacttccggctcgaacacgacggggtcctggtg
tcgtgggccgtacccaagaacctgcccaccgaccccgatcagaaccggctcgcggtacag
accgaggaccatccgatggactacgccgacttcgaaggcgacatcccggcgggcgagtac
ggcggcggtcacgtgtcgatctgggacaagggcacattcgagctcgagaagtggcgcgac
aaggaggtcatcgtccgcctccacggcgagcgggcgcagggccggtatgcgttgatccgg
accggcgagaagaactggctggcccacctcatgagcgacgagccgcgtccgatcgtcccc
gacagcctcaccgacccgcgccccatgctggcgaccgatgagtcgatcgacgggctcaac
ggtcgcgactgggcgttcgagggcaagtgggacggataccggttgctcatccgctcggtc
ggcggcgagttccggctcacctcgcgatccggtatcgacatgaccgccgacttccccgaa
ctcgccggtctcgcagacgatctcgggctcatggacgtggtactcgacggtgaggtcgtc
gcgatcgactcctccggccgcaccaacttcacgctcctgacctcgcgccggcacaccgac
gagccgtactcgctccggttgcacctgttcgacatcctgttcctcaacggctcgtcgtta
ctgcgcaaaccgtggtcggtccgccgtgaactgctcgaggaactggcacccgcgttccgc
aactcagccttcgtcgaggttccgccgctgcttcccggtccgggttcggccgccgtcgag
tacagccgcgaacacaatctggaaggcgttgtcgccaaacgtcgcaactccgtgtaccag
caggggcgacggtcgacgacgtggctgaaacacaagaactggagcgacatcgaggtcgtc
gtcggcgggttccgaccggggcgcggcaaccgctcccacaccatcggctcgttgctgatc
ggtctgcccgaggagaccggattgcgctacgtcggccgcgtcggcaccggtttcaccgac
gcgcagctgcgttcgctcgccgaggaactcggcccgctggagatctcgcggtcgccgttt
ctcgacaaactcgaccgacccgtcgcgtcgagcgcggtgtgggtcctgcccaagatcgtc
ggcgaggtccgtttcatggactggacgacggccgggcatctgcggcatcccagctggcgg
gggatccggcgggacaaacttcccggcgacctctga

DBGET integrated database retrieval system