KEGG   Geobacillus thermoleovorans CCB_US3_UF5: GTCCBUS3UF5_28980Help
Entry
GTCCBUS3UF5_28980 CDS       T01676                                 

Definition
(GenBank) Peroxide-forming NADH oxidase/alkyl hydroperoxidase reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
gte  Geobacillus thermoleovorans CCB_US3_UF5
Brite
KEGG Orthology (KO) [BR:gte00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    GTCCBUS3UF5_28980
Enzymes [BR:gte01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     GTCCBUS3UF5_28980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_binding_2 DAO FAD_oxidored AlaDh_PNT_C Thioredoxin_4 NAD_binding_7 FAD_binding_3 Glutaredoxin Thi4 NAD_binding_8 FMO-like K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AEV20201
UniProt: G8N3G7
LinkDB All DBs
Position
complement(2651713..2653242)
Genome map
AA seq 509 aa AA seqDB search
MLLDADIKAQLAQYLQLLENDIVLTVSAGDDNVSRDMLALIDELTAMSSKIKVEKAKLER
TPSFSVNRVGENTGITFAGVPLGHEFTSLVLALLQVSGRPPKVSQDVVDRIQQIRGKHHF
ETYVSLTCHNCPDVVQALNIMSVLNPDISHTMIDGAAFKEEAEQKGIMAVPTVFLNGKLF
ASGRMSLEDILAKLGSAPDASSFADKEPFDVLVIGGGPAGATAAIYAARKGIRTGIVAER
FGGQILDTLGIENFISVKYTEGPKLAASIEEHVKQYNVDIMNSQRAKRLEKKDLIEVELE
NGAVLKSKTVVIATGARWRNLGVPGEEEFKNKGVAYCPHCDGPLFEGKHVAVIGGGNSGV
EAAIDLAGIASHVTLLEFAPELKADAVLQDRLYSLPNVTVIKNAQTTEITGTDKVNGLTY
IDRETGEEHHIELQGVFVQIGLVPNTEWLEGTVERNRFGEIIVDKRGATNIEGVFAAGDC
TDSAYKQIIISMGSGATAALSAFDYLIRH
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgctgctggatgctgacatcaaggcgcaactagcccagtatttgcaattgcttgaaaat
gatattgtcttgacggtaagcgcgggagacgacaacgtttcccgcgatatgcttgcttta
atcgatgaattaacggcgatgtcgtcgaaaatcaaagtggaaaaagcgaagctggaacga
acgccaagcttcagcgtcaaccgggtcggcgaaaacaccggcatcaccttcgccggcgtg
ccgctcggccatgaatttacgtccctcgttttggcgctgcttcaagtgagcgggcggccg
ccgaaagtcagccaagacgtcgtggaccgcattcaacaaatcagaggcaaacatcatttt
gaaacgtacgtcagcctgacctgccacaactgcccggacgtcgtgcaagcgctcaacatt
atgagcgtgttgaacccagatatttcgcatacgatgatcgacggggcggcgtttaaagaa
gaagcggagcaaaaagggattatggccgtaccgacggtgtttttaaacggcaaactgttc
gcgagcggccgcatgtcgcttgaagatatcctcgccaaattagggagtgctccggatgct
tcttccttcgccgacaaagagccgttcgacgtgttggtgatcggcggcggccctgcgggt
gcgacagcagccatttacgcagcgcgcaaaggcattcgcactgggattgttgcggagcgc
ttcggtggacaaattttagatacgctcggcattgaaaactttatcagcgtcaaatatacg
gaaggaccgaagcttgcggccagcattgaggaacatgtgaagcaatacaacgtcgacatc
atgaactcgcagcgggcaaaacgactcgagaaaaaagacttgattgaagtcgagttggaa
aacggcgccgtgttgaaaagcaaaacggttgtgatcgcaacgggcgcccgttggcgcaac
cttggcgtgccgggcgaggaagagttcaaaaacaaaggggtcgcctattgcccgcattgc
gacggcccgctgttcgaagggaagcacgtggcggtcatcggcggcgggaactctggagtc
gaagcggcgattgacctcgctggcatcgccagccatgtgacgctgcttgagttcgcccct
gaactcaaggccgatgctgttttgcaagatcgtttgtacagcttgccgaacgtaacggtg
attaaaaacgcgcaaacgacggaaatcaccggcacggacaaagtcaacggcttgacgtac
attgaccgggaaacaggggaagaacatcatatcgaattgcaaggcgtgttcgtgcaaatc
ggccttgttccgaacaccgaatggttggaaggaacggtggaacggaatcgcttcggtgaa
attatcgtcgataaacgcggcgcgacgaacattgaaggcgtctttgccgcgggcgactgc
acggacagcgcctataagcaaatcattatttcgatgggctcgggtgcaaccgcagcgtta
agcgcgtttgattatttgattcgccattaa

DBGET integrated database retrieval system