KEGG   Geobacillus thermoleovorans CCB_US3_UF5: GTCCBUS3UF5_29080Help
Entry
GTCCBUS3UF5_29080 CDS       T01676                                 

Definition
(GenBank) hypothetical protein
Organism
gte  Geobacillus thermoleovorans CCB_US3_UF5
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Post_transc_reg
Motif
Other DBs
NCBI-ProteinID: AEV20211
UniProt: G8N3H7
LinkDB All DBs
Position
complement(2663475..2663762)
Genome map
AA seq 95 aa AA seqDB search
MDENRKLREQLMPALESKCDEFRLLGYTQVTMDGLWECLCSRKWKHRPAEKKLHELVSDI
FSLSPSEYMMFLTMRSYKQQAAGDDELERVLKELL
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atggatgaaaaccggaagctgcgcgaacagctcatgcctgcgctcgagtcgaagtgcgat
gagtttcgtcttctcggctatacgcaagtgacgatggacgggctgtgggaatgtttatgt
tcccgcaagtggaagcatcggccggcggaaaaaaaactgcatgagttggtcagcgacatt
ttctctctttcgccgagcgagtatatgatgtttttgacgatgcgttcgtataagcagcag
gcggccggcgatgatgagttggagcgggttttaaaggaattgttatag

DBGET integrated database retrieval system