KEGG   Geobacillus thermoleovorans CCB_US3_UF5: GTCCBUS3UF5_30850Help
Entry
GTCCBUS3UF5_30850 CDS       T01676                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gte  Geobacillus thermoleovorans CCB_US3_UF5
Pathway
gte00010  Glycolysis / Gluconeogenesis
gte00030  Pentose phosphate pathway
gte00051  Fructose and mannose metabolism
gte00052  Galactose metabolism
gte00680  Methane metabolism
gte01100  Metabolic pathways
gte01110  Biosynthesis of secondary metabolites
gte01120  Microbial metabolism in diverse environments
gte01130  Biosynthesis of antibiotics
gte01200  Carbon metabolism
gte01230  Biosynthesis of amino acids
gte03018  RNA degradation
Module
gte_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:gte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GTCCBUS3UF5_30850
   00030 Pentose phosphate pathway
    GTCCBUS3UF5_30850
   00051 Fructose and mannose metabolism
    GTCCBUS3UF5_30850
   00052 Galactose metabolism
    GTCCBUS3UF5_30850
  09102 Energy metabolism
   00680 Methane metabolism
    GTCCBUS3UF5_30850
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    GTCCBUS3UF5_30850
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:gte01009]
    GTCCBUS3UF5_30850
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:gte03019]
    GTCCBUS3UF5_30850
Enzymes [BR:gte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     GTCCBUS3UF5_30850
Protein phosphatases and associated proteins [BR:gte01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     GTCCBUS3UF5_30850
Messenger RNA biogenesis [BR:gte03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     GTCCBUS3UF5_30850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK Peripla_BP_1 NAD_kinase PucR
Motif
Other DBs
NCBI-ProteinID: AEV20387
UniProt: G8N4X7
LinkDB All DBs
Position
complement(2835142..2836161)
Genome map
AA seq 339 aa AA seqDB search
MFKKTYEVGRVQFDANEVEMMKRIGVLTSGGDSPGMNAAIRAVVRKAIYHGVEVYGIYHG
YAGLIAGNIKKLEVGDVGDIIHRGGTILYTARCPEFKTEEGQKKGIEQLKKHGIEGLVVI
GGDGSYQGAKKLTEHGFPCVGVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSH
ERTYVVEVMGRHAGDIALWSGLAGGAETILIPEADYDMDDIIARLKRGHERGKKHSIIIV
AEGVGSGVDFGRQIQEATGFETRVTVLGHVQRGGSPTAFDRVLASRLGARAVELLLEGKG
GRCVGIQNNQIVDHDIAEALAKTHTVDQRMYTLSKELSI
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgttcaagaagacgtatgaggtcggacgtgtgcaattcgatgcaaacgaggtggaaatg
atgaaacggattggtgtgttgacaagcggcggcgactcgccgggcatgaatgcggccatt
cgcgctgtcgtccgcaaagcgatttaccatggggtggaagtgtacggaatctaccacggg
tatgccgggttgatcgccggcaatatcaaaaaactggaagtcggggacgtcggggacatc
atccatcgcggcggcaccatcctttataccgcgcgctgcccggagtttaagacggaagaa
ggacagaaaaaggggatcgagcagctgaaaaagcacggcattgaagggctggtcgtcatc
ggcggcgacgggtcgtatcaaggggcgaaaaaattgacggagcacggcttcccgtgcgtc
ggcgtgcccgggacgatcgacaacgacattccaggcaccgattttacgatcggttttgac
accgcgctcaatacggtcattgacgccattgacaaaatccgcgacacggcgacgtcgcat
gagcggacgtacgtcgtcgaagtgatgggccgccatgccggcgatattgcgctatggtcg
gggcttgccggaggggcggagacgattttgattccggaagcggactacgacatggacgac
atcatcgctcgcttgaagcgcggccatgaacgcggcaaaaaacacagcatcatcatcgtc
gccgagggagtcggcagcggcgtcgacttcggccggcaaattcaagaggcgaccggcttt
gagacgcgcgtgacggtgcttggccacgtgcagcgcggcggatcgccgacggcgtttgac
cgcgtgttagcgagccgcctcggcgcccgtgcggtcgagctgctccttgaaggcaaaggc
ggccgctgcgttggcattcaaaacaaccaaatcgttgaccatgacattgccgaagcgttg
gcgaaaacacatacggtcgatcagcggatgtatacattgtcgaaagagctgtcgatttaa

DBGET integrated database retrieval system