KEGG   Geobacillus thermoleovorans CCB_US3_UF5: GTCCBUS3UF5_31940Help
Entry
GTCCBUS3UF5_31940 CDS       T01676                                 

Definition
(GenBank) Bacillolysin
  KO
K01400  bacillolysin [EC:3.4.24.28]
Organism
gte  Geobacillus thermoleovorans CCB_US3_UF5
Brite
KEGG Orthology (KO) [BR:gte00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:gte01002]
    GTCCBUS3UF5_31940
Enzymes [BR:gte01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.28  bacillolysin
     GTCCBUS3UF5_31940
Peptidases [BR:gte01002]
 Metallo Peptidases
  Family M4: thermolysin family
   GTCCBUS3UF5_31940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M4_C Peptidase_M4 FTP PepSY Caps_synth_GfcC
Motif
Other DBs
NCBI-ProteinID: AEV20496
UniProt: G8N633
LinkDB All DBs
Position
complement(2941162..2942802)
Genome map
AA seq 546 aa AA seqDB search
MNKRAMLGAIGLAFGLMAWPFGASAKEKSMVWNEQWKTPSFVSGSLLKGEDAPEELVYRY
LDQEKNTFQLGGQARERLSLIGKQTDELGHTVMRFEQRYHGIPVYGAVLVAHVNDGELSS
LSGTLIPNLDKRTLKTEAAISIQQAEMIAKQDVADAVTKERPAAEEGKPTRLVIYPDGET
PRLAYEVNVRFLTPVPGNWIYMIDAADGKVLNKWNQMDEAKPGGGQPVAGTSTVGVGRGV
LGDQKYINTTYSSYYGYYYLQDNTRGSGIFTYDGRNRTVLPGSLWADVDNQFFASYDAAA
VDAHYYAGVVYDYYKNVHGRLSYDGSNAAIRSTVHYGRGYNNAFWNGSQMVYGDGDGQTF
LPFSGGIDVVGHELTHAVTDYTAGLVYQNESGAINEAMSDIFGTLVEFYANRNPDWEIGE
DIYTPGIAGDALRSMSDPAKYGDPDHYSKRYTGTQDNGGVHTNSGIINKAAYLLSQGGVH
YGVSVTGIGRDKMGKIFYRALVYYLTPTSNFSQLRAACVQAAADLYGSTSQEVNSVKQAF
NAVGVY
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaacgggcgatgcttggcgcgattgggttggcgtttggattgatggcttggccg
ttcggggcttcggcgaaggaaaaatcaatggtgtggaacgaacagtggaagacgccgtcg
ttcgtttctggttcgctgttaaaaggcgaggatgctccggaagaattggtttaccgttat
cttgatcaagagaagaatacgttccagcttggtggacaagcccgcgaacggctgagcttg
attggcaaacaaacggatgaactcggccatacggtcatgcgttttgaacagcgctatcac
ggcatcccagtgtatggcgccgtgctcgttgcccatgtcaacgatggcgaattgtcctct
ttgtcgggtacgctcattccgaatttggacaaacgaacgttgaaaacagaagctgccatt
tccattcaacaagcggaaatgatcgcgaaacaagatgtggctgatgcggtgacgaaagaa
cggccggcggccgaagagggaaaaccaacgcggcttgtcatctatccggatggggagacc
ccgcgcctcgcctatgaagtcaatgtccgctttttaacccctgtcccaggcaactggatc
tacatgatcgatgccgcagacggaaaagtgttgaacaaatggaaccaaatggacgaggcg
aagccgggcggcgggcagccggtcgccggcacgtcgacggtcggcgtgggccgcggtgtg
ttgggggatcagaaatatatcaatacgacgtattcctcgtattatggctactactatttg
caagacaatacgcgcggcagcggcatttttacgtatgacggacgaaaccgcaccgttttg
cccggcagcttatgggccgatgtcgacaatcaatttttcgccagctatgacgcggcggcc
gtggacgcccattattacgccggcgtcgtgtatgattactacaaaaatgtgcacggccgg
ctaagctatgacggcagcaacgccgccatccgttcgaccgtccattacggccgcggctac
aacaacgcgttttggaatggttcgcaaatggtgtacggcgatggcgacggacagacgttt
ttgccgttttccggcggcattgacgtcgttgggcatgagttgacccatgcggtgacggat
tatacggccgggcttgtttaccaaaacgaatccggcgccatcaatgaagcgatgtccgat
attttcggcacgctcgtggagttctacgccaaccgcaacccggactgggagatcggcgaa
gacatttacacgccgggaattgccggcgacgcgcttcgctccatgtcggatccggcgaaa
tacggcgatccggatcattattccaaacggtacaccggcacacaagacaatggaggagtc
catacaaacagcggcatcatcaataaagcggcgtacttgctcagccaaggcggcgtccat
tacggcgtaagcgtcaccggcatcggccgcgacaaaatggggaaaattttctaccgggcg
cttgtctactatttgacgccgacgtcgaacttcagccagctgcgcgcggcctgcgtgcaa
gcggccgctgatttgtacgggtcgacaagccaagaagtcaactcggtgaaacaggcgttc
aatgcggttggagtgtattaa

DBGET integrated database retrieval system