KEGG   Geobacillus thermoleovorans CCB_US3_UF5: GTCCBUS3UF5_32840Help
Entry
GTCCBUS3UF5_32840 CDS       T01676                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
gte  Geobacillus thermoleovorans CCB_US3_UF5
Brite
Enzymes [BR:gte01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     GTCCBUS3UF5_32840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu AHSA1 LPAM_2 NusG_II
Motif
Other DBs
NCBI-ProteinID: AEV20586
UniProt: G8N6S7
LinkDB All DBs
Position
complement(3029079..3029600)
Genome map
AA seq 173 aa AA seqDB search
MRKTYGVVLAAALVLSGCGQENGTSRTVEMINADGDSIGTIELTEQAEGVRLKLDLEGLP
PGEHAIHIHENGSCKPPDFQSAGGHYNPDGKKHGLLHPEGAHAGDLPNIIVKDDGTVNVE
LKAPNVTLKEGEKGSLLTKDGTSIVIHAKKDDGMTQPAGDAGGRIACGEIKSS
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
ttgcgaaaaacgtacggtgtggtgctggcggcagcgctcgtgttgtccggctgcggccaa
gagaatggaacgagccggacggtggagatgatcaatgcggatggcgattcgatcggtacg
atcgagttgactgaacaggcggaaggggtgcggctgaagcttgacttggaaggcctcccg
ccgggagagcacgccattcacatccatgaaaacggaagctgcaaaccgcccgatttccaa
tcggccggcggtcattacaatccggacgggaaaaagcacggccttctccacccggagggg
gcgcatgccggcgatttgccgaacattattgtgaaggatgacggcacggtcaacgtcgag
ttgaaggcgcccaatgtgacgctgaaagaaggagagaaaggctcgctgcttacgaaagac
ggaacatcgatcgtcattcacgccaagaaagacgacggcatgacccagccggcgggagac
gccggcggacggatcgcctgcggggaaatcaagtcgtcgtga

DBGET integrated database retrieval system