KEGG   Geobacillus thermoleovorans CCB_US3_UF5: GTCCBUS3UF5_35640Help
Entry
GTCCBUS3UF5_35640 CDS       T01676                                 

Definition
(GenBank) hypothetical protein
Organism
gte  Geobacillus thermoleovorans CCB_US3_UF5
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATG16 DUF812 DUF3552 HrpB7 Cep57_CLD Spc29 HemX DUF3450 WASH_WAHD DUF16 Matrilin_ccoil Tropomyosin_1 Fib_alpha Atg14 LPP Macoilin TMF_DNA_bd DUF1664 Tropomyosin Allexi_40kDa DUF2247 YlbD_coat DUF2721 APG6_N DUF1978 Halogen_Hydrol Spc7
Motif
Other DBs
NCBI-ProteinID: AEV20865
UniProt: G8MXV4
LinkDB All DBs
Position
complement(3278609..3279373)
Genome map
AA seq 254 aa AA seqDB search
MPASCHYQKIKEELVMLKKGWPILVASMLVASPAWAAAKPAGKAHERETMVKKVEVVVKK
KTEQKETEAKKKQESSKQQKWLAQKLAQLHKKVGQIEERLDKVTARIQALSEAESATDTQ
TTPADSLPTGESSASQPTEVTAATDAPSGQAIAANDAAAPASSGQTVTEAPSPNSPQPVG
EDQEELDEEKQEQIDGLIGQLIALSNQLRAVTNEIRALEKKVGANNADIQKVKEKVKALN
DQVQANKKALLQLL
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgccagccagctgccattaccaaaaaataaaggaggaattggtaatgttgaagaaagga
tggccgattttggtggcgtcgatgctcgtcgcctctccggcgtgggcggccgccaaacct
gcgggcaaagcgcatgagcgcgaaacgatggtgaagaaagtggaagtcgtcgtcaagaag
aagacggaacaaaaggaaacagaggcgaagaaaaaacaggaatcgtccaagcaacaaaaa
tggcttgcgcaaaagttggcgcagttacataaaaaagtaggccaaattgaagagcggcta
gacaaagtgaccgctcgcattcaagcattgagcgaagcggaatcggcaacggacacgcaa
acgacgcctgctgattcgttgccaacgggcgagtcgtctgcttctcaaccgacagaagtc
acagcggcaactgacgctccgagtggacaagccatagcggccaatgacgctgccgctcca
gcttccagcgggcaaacggtaacggaggcgccgtctccgaattctccacaacctgttggt
gaagaccaagaggaactcgatgaagaaaaacaagagcaaattgatggcctcatcggccag
ctcatcgcgctgtccaaccagctgcgggcggtgacgaatgaaattcgcgcccttgaaaag
aaagtcggcgccaacaacgcagacattcagaaggtaaaagaaaaagtcaaggcgttgaac
gaccaagtgcaagcgaacaaaaaggcgttgcttcagttgctgtag

DBGET integrated database retrieval system