KEGG   Geobacillus thermoleovorans CCB_US3_UF5: GTCCBUS3UF5_35830Help
Entry
GTCCBUS3UF5_35830 CDS       T01676                                 

Definition
(GenBank) Aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
gte  Geobacillus thermoleovorans CCB_US3_UF5
Pathway
gte00010  Glycolysis / Gluconeogenesis
gte00620  Pyruvate metabolism
gte01100  Metabolic pathways
gte01110  Biosynthesis of secondary metabolites
gte01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GTCCBUS3UF5_35830
   00620 Pyruvate metabolism
    GTCCBUS3UF5_35830
Enzymes [BR:gte01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     GTCCBUS3UF5_35830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: AEV20884
UniProt: G8MYD4
LinkDB All DBs
Position
3296437..3298131
Genome map
AA seq 564 aa AA seqDB search
MPQKRRGAFSHHHLYCRIGIFDLTVLSSHDIVFIGKNFYNILSFVSEYKKTQMKEESGMI
YAQPGQPGALVTFKKRYENFIGGKWVPPVDGEYFENITPITGQPYCEVPRSKAADIELAL
DAAHAAKDAWGRTSPAERARLLNKIADRMEENLEMLAVAETWENGKPIRETLAADIPLAI
DHFRYFASCIRAQEGTISEIDHDTVAYHFKEPLGVVGQIIPWNFPILMAAWKLAPALAAG
NCVVLKPAEQTPTSILVLIELIEDLLPPGVVNIVNGFGLEAGKPLASNPRVAKVAFTGET
TTGRLIMQYASQNIVPVTLELGGKSPNIFFADVMDKDDEFLDKALEGFTMFALNQGEVCT
CPSRALIHESIYDAFMERALERVKQIKQGNPLDTETMIGAQASSEQLEKILSYIDIGKQE
GAELLIGGERNMLEGELAGGYYVKPTVFKGHNKMRIFQEEIFGPVLAVTTFKDHDEALSI
ANETLYGLGAGVWTRDINTAYRFGRGIQAGRVWTNCYHVYPAHAAFGGYKMSGIGRETHK
MMLDHYQQTKNLLVSYSPKKLGLF
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
gtgccccaaaagcggcggggcgccttttctcatcaccatctatactgccgcattggcatt
ttcgatttgacagtattgtccagccatgatattgtattcattggaaagaatttttataat
attctttcgtttgtaagcgaatacaaaaaaactcaaatgaaggaggaatcggggatgatc
tacgcacaaccaggccagccaggcgcgcttgtcacatttaaaaagcgctacgaaaacttc
attggcggcaaatgggtgccgccggtcgacggcgagtatttcgaaaatatcacgccaatc
accggacagccgtattgcgaagtgccgcgctcaaaagcggcggacatcgaactggcgctt
gacgccgcccatgcggcaaaagacgcatggggacgcacgtctccagcggagcgcgcccgt
ttgttgaacaaaatcgccgaccggatggaagaaaacttggaaatgctcgccgttgcggaa
acatgggaaaacggcaagccgatccgcgaaacgttggcggctgacatcccgcttgccatc
gaccatttccgctacttcgccagctgcattcgcgcgcaagaaggcacgatttcggaaatc
gatcacgacacggtcgcctatcatttcaaagaaccgctcggcgtcgtcgggcaaatcatc
ccgtggaacttcccgattttaatggcggcctggaaactcgctccagcgctcgcggccggc
aactgcgtcgtcttgaaaccggcggagcaaacgccgacgtcgatcctcgttctcatcgaa
ctcatcgaggatttgcttccacctggcgtcgtcaacatcgtcaacggctttggcttagaa
gccggcaagccgctcgcctcgaacccgcgcgtggcgaaagtggcgttcaccggtgaaacg
acgaccggacggctcatcatgcagtacgcctcgcaaaacatcgtgccggttacgcttgag
cttggcggcaagtccccgaacattttcttcgctgatgtgatggacaaagacgacgagttt
ctcgataaagcgctcgaaggctttacgatgttcgccttaaaccaaggcgaagtgtgcaca
tgcccgtcgcgcgccctcatccatgagtcgatttacgacgcctttatggaacgggcgctt
gagcgcgtcaagcaaatcaagcaaggcaatccgctcgatacggaaacgatgatcggcgcc
caagcctcctccgaacagctcgagaaaattttgtcatacatcgacatcggcaaacaggaa
ggcgctgagctcttgatcggcggcgagcggaacatgctcgaaggagaactcgccggcggc
tattacgtcaagccgaccgttttcaaagggcataacaaaatgcgcattttccaagaagaa
attttcggcccagtgctcgcggtcacaacgtttaaagatcacgacgaagcgctttcaatc
gccaatgaaacgctgtacggccttggcgccggcgtctggacgcgcgacatcaacaccgcg
taccgcttcggccgcggcatccaagccggccgcgtctggacgaactgctatcacgtctat
ccggcccacgcggcgtttggcggctacaaaatgtccggcatcggccgcgaaacgcacaaa
atgatgctcgaccattaccaacaaacgaaaaacttgctcgtcagctattcgccgaaaaaa
cttggcttgttctaa

DBGET integrated database retrieval system