KEGG   Geobacillus thermoleovorans CCB_US3_UF5: GTCCBUS3UF5_750Help
Entry
GTCCBUS3UF5_750   CDS       T01676                                 

Definition
(GenBank) 33 kDa chaperonin
  KO
K04083  molecular chaperone Hsp33
Organism
gte  Geobacillus thermoleovorans CCB_US3_UF5
Brite
KEGG Orthology (KO) [BR:gte00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:gte03110]
    GTCCBUS3UF5_750
Chaperones and folding catalysts [BR:gte03110]
 Heat shock proteins
  HSP33
   GTCCBUS3UF5_750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-ProteinID: AEV17404
UniProt: G8N066
LinkDB All DBs
Position
79656..80546
Genome map
AA seq 296 aa AA seqDB search
MKMGDYLVKALAYNGQVRAYAARTTETVAEAQRRHQTWPTASAALGRALTAGVMMGAMLK
GEETLTIKIDGGGPIGVILVDSNARGEVRGYVTNPHVHFELNEHGKLDVARAVGKNGMLT
VVKDLGLRDFFTGQVPLISGELGDDFTYYFASSEQIPSSVGVGVLVNPDHTIRAAGGFII
QLMPGTEENTITRIEERLKQIPPVSRMIERGLSPEQLLEQLLGDGGVRVLETMPVSFVCR
CSRERIADALISLGPEEIQDIIDKEGQAEASCHFCNETYHFDKAELEQLKQLAKKE
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgggagactacttagtcaaagcactcgcttacaatggacaagtgagagcgtat
gccgcaagaacgacggaaactgtcgccgaggcgcaacgccgccaccaaacatggccgacc
gcctcagcggctctcggccgggcgttgaccgccggtgttatgatgggagcgatgctgaaa
ggcgaggaaacgttgacgattaaaattgacggcggcggcccgatcggcgtcattttagtt
gacagcaacgccagaggggaagtgcgtggctatgtaacgaatccacatgtacattttgag
ctgaacgagcatgggaaacttgatgtggcacgggcggtcggcaaaaatgggatgttgacg
gttgtgaaggatcttgggctgcgcgactttttcaccggacaagtgccgcttatctccggg
gagcttggcgatgattttacgtattattttgcttcgtccgaacaaattccgtcatcggtt
ggcgtcggggtgctcgtcaatcccgaccataccatccgagccgccggaggatttattatc
cagttgatgcccgggacggaggagaacacgatcactcgcattgaagagcggctgaaacaa
attccgcccgtgtcgcgcatgatcgaaagagggctcagcccggaacagctgctcgaacaa
ctgttgggagatggaggcgtccgtgtgctcgagacgatgccggtgtcattcgtctgccgt
tgttcgcgcgagcggatcgctgatgcccttatcagcctagggcccgaggaaatccaagac
atcatcgacaaagaagggcaggcggaagcttcgtgccatttttgcaatgaaacgtaccat
ttcgacaaagcggagctggaacagttgaaacaactcgcaaaaaaagaatga

DBGET integrated database retrieval system