KEGG   Geobacillus thermoleovorans CCB_US3_UF5: GTCCBUS3UF5_8140Help
Entry
GTCCBUS3UF5_8140  CDS       T01676                                 

Definition
(GenBank) Alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
gte  Geobacillus thermoleovorans CCB_US3_UF5
Pathway
gte00010  Glycolysis / Gluconeogenesis
gte00071  Fatty acid degradation
gte00350  Tyrosine metabolism
gte00625  Chloroalkane and chloroalkene degradation
gte00626  Naphthalene degradation
gte01100  Metabolic pathways
gte01110  Biosynthesis of secondary metabolites
gte01120  Microbial metabolism in diverse environments
gte01130  Biosynthesis of antibiotics
gte01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gte00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GTCCBUS3UF5_8140
  Lipid metabolism
   00071 Fatty acid degradation
    GTCCBUS3UF5_8140
  Amino acid metabolism
   00350 Tyrosine metabolism
    GTCCBUS3UF5_8140
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    GTCCBUS3UF5_8140
   00626 Naphthalene degradation
    GTCCBUS3UF5_8140
Enzymes [BR:gte01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     GTCCBUS3UF5_8140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C Methyltransf_25 3HCDH_N TrkA_N
Motif
Other DBs
NCBI-ProteinID: AEV18137
UniProt: G8N731
LinkDB All DBs
Position
complement(775312..776322)
Genome map
AA seq 336 aa AA seqDB search
MKAAVVHKFKQKLQIEEVEKPKLGYGEVLVKIEACGVCHTDLHAAHGDWPVKPKLPLIPG
HEGVGIVVEIGEGVKSIQIGDRVGIPWLYSACGECEYCLSGQETLCPHQLNGGYSVDGSY
AEYCKAPANYVARIPKNLDPVQVAPILCAGVTTYKALKVSNAKPGEWVAIYGIGGLGHIA
LQYAKAMGLNVVAVDISDEKAELAAKLGADITINGLQEDPVAAIREKVGGVQAAISVAVT
KKAFEQAYQSVRRGGCLVIVGLPHDELPIPIFDTVLNGVTIKGSIVGTRKDMQEALDFAA
RGKVRPIVEAVPLEKINEVFERMEKGQINGRVVLTM
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgccgttgttcacaaattcaagcaaaaacttcaaattgaagaagtggagaaa
ccaaaactaggatatggcgaagtgcttgtgaaaattgaagcttgtggcgtctgccatacc
gatttgcatgcggctcatggggattggccggtaaaaccgaaacttccacttattcctggt
catgaaggggtaggaattgttgttgagatcggtgagggagtgaaatcaatccaaattggc
gaccgtgttggcattccatggttatactcagcatgcggtgaatgtgaatattgtttaagc
ggtcaagaaacactttgtccacatcaattaaacggtggatactctgtcgatggcagttat
gcagaatattgcaaagccccggccaattatgtcgcacgaattcctaaaaacctcgatccc
gtacaagttgctcctattctttgtgctggggtcacaacgtataaagcattaaaagtttca
aatgccaagcctggcgaatgggtcgctatttatggaatcgggggattgggccatattgct
cttcaatatgccaaggcaatgggattaaatgttgttgctgttgatatcagtgatgaaaag
gcagaacttgcggcaaagttgggtgctgatattacgatcaatggattgcaagaagaccct
gtagcagccattcgtgaaaaagtaggcggagtacaagcggctattagcgttgctgtaacg
aaaaaagcgttcgaacaagcttatcaatccgtgcgacgcggcggctgccttgtcatagtt
ggactgcctcacgatgaactgccgattcctatttttgacactgtattaaatggcgttacg
ataaaaggttcgatcgtcggtacacgaaaagatatgcaagaagctctagatttcgccgca
cgcggaaaagttcgccctattgtggaagcggtaccattagaaaaaattaacgaagtattt
gaacggatggaaaaaggtcaaatcaatggccgcgttgttttaacaatgtaa

DBGET integrated database retrieval system