KEGG   Parageobacillus thermoglucosidasius C56-YS93: Geoth_0087Help
Entry
Geoth_0087        CDS       T01531                                 

Definition
(GenBank) Hsp33 protein
  KO
K04083  molecular chaperone Hsp33
Organism
gth  Parageobacillus thermoglucosidasius C56-YS93
Brite
KEGG Orthology (KO) [BR:gth00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:gth03110]
    Geoth_0087
Chaperones and folding catalysts [BR:gth03110]
 Heat shock proteins
  HSP33
   Geoth_0087
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-ProteinID: AEH46147
LinkDB All DBs
Position
78123..79013
Genome map
AA seq 296 aa AA seqDB search
MSDYLVKALAYDGQVRAYAARTTDTVSEAQRRHQTWPTASAALGRAITAGVMMGAMLKGD
DKLTIKIDGGGPIGTILVDSNAKGEVRGYVTNPHVHFDLNEHGKLDVAKAVGTNGMLTVV
KDLGLRDFFTGQVPIVSGELGEDFTYYFASSEQVPSSVGVGVLVNPDNTILAAGGFIIQL
MPGTEEKTIDEIEKRLRTIPPVSKMVESGLTPEEILEELLGKGNVKVLETIPVAFVCRCS
RERIADALISLGAQEIQDIIDKEGYAEASCHFCNETYHFSKEELQQLKQLADAKEE
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgtcagactacttagtaaaggctttagcttatgatggacaagtaagagcgtatgctgct
cgaacaacagatacagtaagcgaggcgcagcgccgccatcaaacatggccgactgcttcc
gcggcgcttggccgggctattacggcgggagtcatgatgggagccatgttaaagggtgat
gataaattaacgattaaaattgatggcggcggtccgattggcaccatcctcgtcgacagc
aatgcgaagggagaggtgcgtgggtacgtaacaaatccacacgtccactttgatttaaac
gaacatgggaaattggacgtcgccaaagcggtaggcacaaacggcatgttaacggtcgta
aaagatttagggctgcgcgattttttcacagggcaagtgccgattgtctcaggagaactt
ggtgaagattttacgtattattttgcttcttctgagcaagttccatcttctgtcggcgtc
ggtgtgcttgtcaatcccgataacacgatcttggcggcgggaggctttatcatccagctg
atgccgggaacggaagagaagacaattgatgagattgaaaaacgcttgcggactattcca
cctgtctcgaaaatggtagagagtggattgacgccagaagagattttggaagagttgctt
ggaaaaggaaatgtcaaagtgctagaaacaattccagtcgcgtttgtttgccgctgttcg
cgggagcgaattgcggatgcgttgatcagtttaggcgcgcaggaaattcaagacattatc
gacaaagaagggtatgctgaagcgtcatgccatttctgcaatgaaacgtaccatttcagc
aaagaggaactccagcagctgaaacagcttgctgatgcgaaagaagaataa

DBGET integrated database retrieval system