KEGG   Parageobacillus thermoglucosidasius C56-YS93: Geoth_0268Help
Entry
Geoth_0268        CDS       T01531                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
gth  Parageobacillus thermoglucosidasius C56-YS93
Pathway
gth00010  Glycolysis / Gluconeogenesis
gth00620  Pyruvate metabolism
gth01100  Metabolic pathways
gth01110  Biosynthesis of secondary metabolites
gth01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gth00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Geoth_0268
   00620 Pyruvate metabolism
    Geoth_0268
Enzymes [BR:gth01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     Geoth_0268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487 OmdA
Motif
Other DBs
NCBI-ProteinID: AEH46316
LinkDB All DBs
Position
complement(274717..276237)
Genome map
AA seq 506 aa AA seqDB search
MIYAQPGQPGSLITFKKRYENFIGGKWVPPVDGEYFENISPVTGKPYCEVPRSKAADIEL
ALDAAHAAKDAWGRTSPAERARILNKIADRIEENLEMLAVAETWENGKPIRETLNADIPL
AIDHFRYFAGCIRAEEGTLAEIDNDTVAYHFKEPLGVVGQIIPWNFPLLMATWKLAPALA
AGNCVVLKPAEQTPTSILVLMELIEDLLPPGVVNIVNGFGLEAGKPLASSNRIAKIAFTG
ETTTGRLIMQYASQNIIPVTLELGGKSPNIFFEDVAAKDDEFFDKAIEGFTLFALNQGEI
CTCPSRALIQESIYDQFIERALERVKQIKQGNPLDTETMIGAQASSEQLEKILSYIDIGK
QEGAELLIGGERNFLEGDLRDGYYVKPTVFKGHNKMRIFQEEIFGPVVSVTTFKDVNEAL
EIANETLYGLGAGVWTRDINTAYRVGRGIQAGRVWTNCYHIYPAHAAFGGYKLSGFGRET
HKMMLEHYQQTKNLLVSYSPKKLGLF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgatttacgctcaacctgggcagcctggttcgctcatcactttcaaaaaacgctatgaa
aatttcattggcggcaaatgggttccgccggtcgatggcgagtattttgaaaacatctct
ccagtcaccgggaaaccttattgtgaagtgccgcgttccaaagcagcagacattgagtta
gcgttagacgctgcccatgccgcgaaagacgcgtggggccgcacttcccctgccgaacgc
gcgcgaatcctcaacaaaatcgccgaccgcatcgaagaaaacttggaaatgctcgctgtt
gcggaaacatgggaaaacggcaagccgattcgcgaaacgctgaatgcggacattccgctt
gccatcgatcatttccgctattttgccggctgcatccgcgcagaagaagggacgttagcg
gaaatcgacaatgatacagtcgcctatcactttaaagaaccgcttggggttgtcgggcaa
atcatcccatggaacttcccgcttttaatggcaacttggaagctcgcgccagcattagcc
gcgggaaactgcgttgtcctgaaacctgcagaacaaacgccaacttcgatcctcgtgctt
atggaactcattgaagatttgcttcctccaggtgttgtcaacatcgtcaacggattcggc
ttggaagccggaaaaccgctcgcttcaagcaaccgcattgcgaaaattgcattcaccggt
gaaacgacaacagggcgtttaattatgcaatacgcatcgcaaaacattatcccagtaaca
ttagagcttggcggaaaatcgccgaacattttcttcgaagatgttgcggcaaaagatgat
gaatttttcgataaagccattgaaggctttacgctgttcgcgttaaaccaaggtgaaata
tgtacgtgcccttcccgcgctctcattcaagaatcgatttacgaccaatttatagagcgt
gcgttagagcgcgttaaacaaataaaacaaggcaacccgctcgacacggaaacgatgatc
ggcgcccaagcatcttcggaacaattggaaaaaatattatcgtacattgatatcggcaag
caagaaggtgccgaattgcttatcggcggagaacgcaacttcttagaaggagacttaaga
gacggctattatgtgaaaccgacggttttcaaaggccataataaaatgcgcattttccaa
gaagaaattttcgggccggttgtctccgtcacgacgtttaaagatgtcaacgaggcgttg
gagatcgccaacgaaacattgtacggtttaggcgccggcgtctggacacgcgacattaac
accgcttatcgcgtcggacgcggcatccaggcaggacgcgtctggacaaactgctaccac
atctatcctgcgcacgcggcattcgggggctataagttatccggattcggccgtgaaacg
cataaaatgatgcttgaacattatcaacaaacgaaaaacttgcttgtcagctattcgccg
aaaaaacttgggctcttctaa

DBGET integrated database retrieval system