KEGG   Parageobacillus thermoglucosidasius C56-YS93: Geoth_0560Help
Entry
Geoth_0560        CDS       T01531                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase NAD-binding protein
  KO
K07516  3-hydroxyacyl-CoA dehydrogenase [EC:1.1.1.35]
Organism
gth  Parageobacillus thermoglucosidasius C56-YS93
Pathway
gth00071  Fatty acid degradation
gth00362  Benzoate degradation
gth00650  Butanoate metabolism
gth01100  Metabolic pathways
gth01120  Microbial metabolism in diverse environments
gth01200  Carbon metabolism
gth01212  Fatty acid metabolism
Module
gth_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:gth00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Geoth_0560
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Geoth_0560
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Geoth_0560
Enzymes [BR:gth01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Geoth_0560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH ECH_1 ECH_2 ApbA NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AEH46571
LinkDB All DBs
Position
567865..570249
Genome map
AA seq 794 aa AA seqDB search
MVKRIQKAAVLGSGVMGSGIAAHLANVGIPTLLLDIVPRELTKEEEAKGLTLEHKEVRNR
LANQALQKLLKQKPAPFMSKSNLALIETGNFADDFHRLAEVDWIIEAVVENLEIKKSVFA
MVDEVRKPGTIVSSNTSGISIETMAEGRSEDFKKHFLGTHFFNPPRYLKLLEIIPTKDTD
PEVVSYMKTFGEEVLGKGVVMAKDTPNFIANRIGTYGLLVTVREMMKGGYSVGEVDSLTG
PLIGRPKSATFRTLDVVGLDTFIHVANNVFEKVEGEEKEAFRVPDFMKAMLEKGWIGSKS
GQGFFWKQGKDILELNYETLEYEPRKKLTTPAVEASKQAKKLNDKLKALVYADDRAGTFL
WKIIAPVLLYSAKLLGEIADDIVAIDRAMKWGFGWELGPFEMWDALGVEQSVRKMQAEGL
DIPSWVTDMLAAGFPFFYKSEKGQVFYYDRGEYKPIHENPKVIHIKRLKEQRDVIKKNSG
ASLIDLGDDVALLEFHSPNNAIGTDIVQMINYALEEVERNYKGLVIGNQGKNFCVGANLA
MILMEAQDDNYFEIELAVRQFQQAMMNIKYSTKPVVAAPFAMTLGGGVEVCLPSSRIQAA
AETYMGLVEVGVGLIPGGGGNKELYIKYLNSLPSGVHFDLQQVANKVFETIALAKVSGSA
AEARELNFLNQRDGITMNSDHLIHDAKQAVISLYDQGYRPPVRKKVPVVGETGYAAMLLG
AQSMYHSGYISEHDLKIAKKLAYVIAGGKVPYGTEVDEQYLLDLEREAFLSLVGEPKSQA
RMQHMLVKGKPLRN
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagcgcattcaaaaggcggccgtgcttggatctggtgtgatgggttcaggaatt
gcggcacatttagcgaatgtggggataccgacattgcttctcgatattgttccgcgcgag
ttgacaaaggaagaggaagcaaaagggctaacacttgaacataaagaagtacgcaaccgt
cttgctaatcaagcattgcaaaagttgttgaaacaaaagccggcgccgtttatgtccaaa
tccaatcttgctcttattgaaacaggaaattttgcggatgactttcaccgtcttgctgaa
gtggattggattattgaggcagtcgtggaaaatttagaaattaagaaaagcgtatttgca
atggtggatgaagtaagaaaaccgggaacgatcgtcagctcgaacacttcgggaatttcg
atcgaaacgatggcagaaggccgttccgaagactttaaaaaacattttttaggaacgcat
ttcttcaatccgccgcgctatctaaagctgcttgaaatcattccgacgaaagatacagat
ccagaagttgtttcatatatgaaaacatttggcgaagaagtgcttggcaaaggggttgtc
atggcgaaagatacgccaaatttcattgcaaaccgaatcggcacgtatggcttgttagta
actgttagagaaatgatgaagggcggatacagcgtcggagaagtcgattcgcttacaggg
ccgctgattggccgcccgaaaagcgcaacattccgcacgcttgatgtcgtcggcttggac
acatttattcatgttgccaataacgtatttgaaaaagtagaaggggaagaaaaagaggcg
tttcgcgttccggattttatgaaagcgatgctggaaaaagggtggatcggcagcaaatca
gggcaaggcttcttttggaaacaaggaaaagatattttggagcttaattatgagacgctg
gaatatgagccgcgcaaaaagctgacgactccagcggtggaagcgagcaagcaggcgaaa
aagctgaatgataaattgaaagcgcttgtatatgcggatgaccgcgctggaacgttcctt
tggaaaatcattgctccagttctcctctattctgcgaaattgcttggcgaaatcgctgat
gacattgtcgctatcgaccgcgcgatgaaatggggatttggctgggagcttggtccgttt
gaaatgtgggatgcgcttggcgttgagcaatctgtccggaaaatgcaagcagaaggattg
gacattccttcgtgggtaacggatatgcttgcggctggcttcccgtttttctacaaatcg
gaaaaagggcaagtattttattatgatcgcggagaatacaagccaattcatgaaaacccg
aaagtcattcacataaagcgcttgaaggaacaaagagatgtcattaagaaaaacagcggc
gcaagtttaatcgatcttggcgatgatgttgcattgttagagttccactcgccaaataac
gcgatcggtacggatattgtgcaaatgattaactatgcccttgaggaagtggagaggaac
tataaagggcttgtcatcggcaatcagggaaaaaacttctgtgtcggtgcaaaccttgcg
atgattttaatggaagcacaagatgacaactattttgaaattgagcttgctgttcgccaa
ttccaacaagcaatgatgaatattaagtatagcacgaaaccagtcgttgccgcgccgttt
gcgatgacgctcggaggcggtgtggaagtttgcctgccatcatcccgaattcaagccgcg
gcggaaacgtatatgggacttgtcgaagtcggcgtcggcctcattcctggcggcggcgga
aataaagagctttatattaaatatttaaatagtctgccaagcggagtccatttcgatttg
cagcaagtagcgaataaagtgtttgaaacgatcgcgctggcaaaagtatccggatctgcg
gcagaagcgcgtgaactaaattttttaaatcagcgtgatggcattacgatgaatagcgat
catttaattcatgatgcgaagcaggcggtcatttctctttatgatcaaggttatcgtccg
cctgttcgcaaaaaggtgcctgttgtcggcgaaacaggttatgcggcgatgctgcttggc
gcgcagtcgatgtatcactctggatacattagtgaacacgatttgaaaatcgcgaaaaaa
cttgcgtacgtcattgctggcggaaaagtcccgtacggcacggaagttgatgaacaatat
ttgcttgatttagaaagggaagcgtttttaagcctggtcggcgaaccgaaatcacaggcg
agaatgcagcatatgcttgttaaagggaaaccgctgcgcaactaa

DBGET integrated database retrieval system