KEGG   Parageobacillus thermoglucosidasius C56-YS93: Geoth_0579Help
Entry
Geoth_0579        CDS       T01531                                 

Definition
(GenBank) protein of unknown function DUF81
  KO
K07090  uncharacterized protein
Organism
gth  Parageobacillus thermoglucosidasius C56-YS93
Brite
KEGG Orthology (KO) [BR:gth00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Geoth_0579
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE DUF4231
Motif
Other DBs
NCBI-ProteinID: AEH46589
LinkDB All DBs
Position
586484..587305
Genome map
AA seq 273 aa AA seqDB search
MGDVLLLVIVGFLAGTVGSLVGLGGGVIIVPSLLFLGAIHWLPHVTPQVAVGTSLVVIIF
NGLSSTLSYMKEKMVDYRSGLLFFIGSGPGAIIGAWMNNKLSLEHFSLYFGLFLIAVSFF
LSFSSNASARSQRKPFKITRTYITNEGETVTYGYHPLAAIAISFVVGFFGGMFGIGGGSL
MVPAMIILFFFPPHVAVATSMFMIFLSSLVSSLTHVFMGNVQWLFALSLIPGVWFGAKTG
AFINKRLRSKTIVIALRLVLVLLGIRLIYQSFS
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgggagacgtattattgctagttattgtcggctttttggcagggacggtcggaagttta
gtcgggttgggcggcggcgtgatcattgtgccatctttgttgtttttaggcgctatacac
tggttgccgcacgtcaccccgcaagtggcggttggtacttcgcttgtcgtcattattttt
aatggattatcatcgacattatcgtatatgaaggagaaaatggtggattaccgaagcggg
cttttattttttatcgggagcggccctggagcgatcatcggtgcttggatgaataataag
ttaagcttggagcatttttcgctatatttcgggctgtttttaatcgctgtatcgtttttt
ttatctttcagcagcaatgcttcggcgcgctcacagagaaagccgtttaaaattacgcgt
acttatatcacaaatgaaggggaaacggtgacatatggataccatccgctcgccgctatt
gccatttcttttgtcgttggcttttttggcggcatgtttggcatcggcggcggttcgtta
atggttccggcaatgatcattttatttttctttcctccgcacgtcgctgttgcgacttcc
atgtttatgatctttttatcctctcttgttagctcgctgacgcacgtttttatgggaaat
gtccaatggctgtttgcgctttctttaattccgggtgtttggtttggagcgaaaacgggt
gcgttcattaataaacggctccgcagcaaaacgattgtgatcgccttgcgcctcgtgctt
gttctgttaggaatccgtcttatttatcaaagcttttcataa

DBGET integrated database retrieval system