KEGG   Parageobacillus thermoglucosidasius C56-YS93: Geoth_0652Help
Entry
Geoth_0652        CDS       T01531                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K21802  vanillin dehydrogenase [EC:1.2.1.67]
Organism
gth  Parageobacillus thermoglucosidasius C56-YS93
Pathway
gth00627  Aminobenzoate degradation
gth01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gth00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Geoth_0652
Enzymes [BR:gth01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.67  vanillin dehydrogenase
     Geoth_0652
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AEH46662
LinkDB All DBs
Position
complement(650753..652213)
Genome map
AA seq 486 aa AA seqDB search
MVNFKLLNKQYISGEWKDGTSNRQLIDFNPYNNEVITTFTCASLKDVDEAYRSAKEAQKK
WQHTNPIEKRAVFENAVKYIEENKESIENIIIEELGGTKLKAAFEIDLVINIIKEAATYP
FRMEGKILPSPVDGKENRLYRIPVGVVGVISPFNFPFFLSMKSVAPALGAGNGVVLKPHE
HTPITGGTLIAKIFEEAGLPKGLLNVVITEIEEIGDGFIEHPIPKVISFTGSSKVGKHIG
EVAGRHLKKVSLELGGNSALIVLDDADIDLAVSAAVFSRFTHQGQICMSANRIIVHEKVY
DEFLTKYVRKVASLKCGDPRDPETIIGPLMNERQVQMIINLIETGIKEGATPILKGEVKG
NIVEPVIFTDVTPDMTIAKEELFGPVVCIMKVENDQQAIEYANNSDFGLSGAIHTSNIER
GAEMAKQIETGMIHINDGTINDEPIVAFGGEKNSGLGRLNGSWSLDAFTTVKWISIQHTP
RKYPYS
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggtaaatttcaagttattaaataagcaatatatcagtggagaatggaaagatggcacc
agcaacagacaactgatagattttaatccatacaacaatgaagtgattacaacatttaca
tgcgccagcttaaaagacgttgatgaagcctatcgatcagccaaagaagcccaaaaaaag
tggcaacatacgaaccctattgaaaaaagagctgtttttgaaaatgcggtaaaatatatt
gaagagaataaagaatctattgaaaacatcattatcgaagaacttggcgggacaaaactg
aaagcagcttttgaaattgatcttgttatcaatataatcaaagaagcagctacatatcct
tttcgaatggaaggaaaaattttaccatccccagttgatgggaaagaaaatcgcctatat
cgcattcctgttggagttgtcggtgtgattagtccttttaactttccgtttttcctttct
atgaaatcggtcgctcccgcattaggagcaggaaacggtgttgtgctaaagccacatgag
catacgcctatcaccggtggaacgctcattgccaaaatttttgaagaagcaggtctgcca
aaaggtctgctaaatgttgttataactgaaattgaggaaattggcgacggattcattgaa
catccaattccaaaggttatttcatttacaggttcaagtaaagttggaaaacatatcggt
gaagttgccggacgtcatttgaaaaaagtctcattggagcttggaggaaatagtgcactg
attgtcctggatgatgccgatattgatcttgctgtcagtgcagcggttttcagccgtttt
acacatcaaggccaaatttgtatgtcagcgaatcgaattatcgttcatgaaaaagtatat
gatgaatttttaacaaaatatgtacgtaaagtagctagtttgaaatgcggcgatccacga
gaccctgagacgattattggaccgttgatgaatgaaagacaagttcaaatgattatcaac
cttattgaaacaggcataaaagaaggcgcaacccctattttaaaaggagaagtgaaggga
aatattgtagaacccgtcatatttaccgatgttacgccggatatgacgattgccaaagaa
gagctttttggcccagttgtatgcattatgaaagttgaaaatgaccaacaagcaattgag
tatgccaacaacagcgattttggcttaagcggcgccatccatacatccaatattgaacgc
ggcgcggagatggcgaaacagattgaaactggtatgattcatattaacgacggaaccatc
aatgatgaaccaatagttgcatttggcggagaaaaaaattcaggattaggacgactcaac
ggctcatggagcttagatgcgtttacaactgttaaatggatttccattcaacatacaccg
agaaaatacccatattcgtaa

DBGET integrated database retrieval system