KEGG   Parageobacillus thermoglucosidasius C56-YS93: Geoth_0969Help
Entry
Geoth_0969        CDS       T01531                                 

Definition
(GenBank) succinate dehydrogenase or fumarate reductase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
gth  Parageobacillus thermoglucosidasius C56-YS93
Pathway
gth00020  Citrate cycle (TCA cycle)
gth00190  Oxidative phosphorylation
gth00650  Butanoate metabolism
gth01100  Metabolic pathways
gth01110  Biosynthesis of secondary metabolites
gth01120  Microbial metabolism in diverse environments
gth01130  Biosynthesis of antibiotics
gth01200  Carbon metabolism
Module
gth_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gth_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gth00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Geoth_0969
   00650 Butanoate metabolism
    Geoth_0969
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Geoth_0969
Enzymes [BR:gth01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Geoth_0969
    1.3.5.4  fumarate reductase (quinol)
     Geoth_0969
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like FAD_binding_3 NAD_binding_8 FAD_oxidored AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AEH46967
LinkDB All DBs
Position
944551..946308
Genome map
AA seq 585 aa AA seqDB search
MKKGKIIVVGGGLAGLMATIKIAEAGVPVELFSLVPVKRSHSVCAQGGINGAVNTKGEGD
SPWEHFDDTVYGGDFLANQPPVKAMCEAAPGIIYMLDRMGVMFNRTPEGLLDFRRFGGTQ
HHRTAYAGATTGQQILYALDEQVRRHEVEGLVTKYEGWEFLGVVLDDEQICRGIVAQDLR
SMEIKAFPADAVIMATGGPGVIFGKSTNSIINTGSAASIVYQQGAYYANGEFIQIHPTAI
PGDDKLRLMSESARGEGGRVWTYKDGKPWYFLEEKYPAYGNLVPRDIAAREIFHVCVDLK
LGINGENMVYLDLSHKDPKELDVKLGGIIEIYEKFMGEDPRKVPMKVFPAVHYSMGGLWV
DYDQMTNIKGLFAAGECDYSIHGANRLGANSLLSAIYGGMVAGPSAVRYIRGLEKSADAM
PSSLYDRYVKQEEERWNNILSMDGTENAYVLHKELGEWMTANVTIVRYNDKLLKTDEKIQ
ELLERYKNISVTDTSKWSNQGATFIRQLYNMLQLARVITLGAYNRNESRGAHYKPEFPER
NDEEWLKTTMARYTPDGPAFHYEDVDVSLIKPRKRDYTKKKEEVK
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaggaaaaatcatcgtagttggtggcggtctagctggactaatggcaacgatt
aagatcgcagaagctggagtgcctgttgaattgttctcgctcgtgcctgttaagcggtct
cactctgtctgtgcgcaaggtgggattaacggcgcggtcaatacgaaaggggaaggcgat
tctccttgggaacattttgacgatactgtatatggcggcgactttttagcaaaccagcct
ccggtaaaagcaatgtgcgaggcggcgccgggcatcatttatatgcttgaccgcatggga
gttatgttcaaccgtactcctgaagggttgcttgatttccgtcgctttggcggcacgcag
catcaccgcactgcatacgcaggggcgacaacagggcagcaaatattatatgcgcttgat
gaacaagtgcgccgccatgaagtagaggggcttgtaacgaaatatgaaggctgggagttt
ttaggcgttgttttagatgacgagcaaatttgccgcggaatcgtcgcacaagacttgaga
tctatggaaattaaagcgttccctgcggatgcggtcattatggcgacaggcgggccaggc
gtcattttcggaaaatcgacgaactcgatcatcaacacaggttcagcggcgtctattgtc
tatcagcaaggcgcgtactatgcaaacggagaatttatccaaattcacccgacggcgatt
ccgggagacgataaattgcggttgatgagtgagtcggcccgcggggaaggcggaagagtc
tggacatataaagacggaaaaccttggtatttccttgaagaaaaatacccggcttatgga
aaccttgtgcctcgtgatatcgcagcaagagaaattttccacgtttgcgttgacttgaag
ctcggtatcaatggggaaaacatggtatatctggatctttcccataaagatccgaaggaa
ttagatgtgaaacttggcgggattattgaaatttacgagaaatttatgggggaagatcct
cgcaaagtgccaatgaaagtgttcccggctgtccactattcgatgggcggcttatgggtc
gattatgaccaaatgacaaacatcaaagggctgtttgccgctggcgaatgcgattactcc
attcacggcgctaaccgtcttggagcgaattccttattatcggcgatttacggtggcatg
gttgctgggccaagcgcggtcagatacattcgcggtttggaaaaatcggcagatgcaatg
ccgtcatcgctgtacgatcgctatgtcaaacaagaagaagaacgctggaacaacatttta
tcgatggatggaacggaaaacgcatatgtgctgcataaagaacttggcgaatggatgacg
gcaaatgtgacgatcgtccgctataacgacaagttgctgaaaaccgatgaaaaaattcaa
gaattgcttgaacgttataaaaatatcagcgtgacggatacatcgaaatggagcaaccaa
ggagcgacatttatccgtcaattgtacaatatgcttcaactggcgcgggtcatcacgctg
ggcgcctacaaccggaacgaaagtcgcggtgcgcactataaaccggagtttccagagcgc
aatgacgaagagtggctcaaaacaacgatggcacgctatactccagatgggccggcattc
cactatgaagatgtcgatgtatcgttgattaagccacgcaaacgcgactacacgaaaaag
aaagaggaagtgaagtaa

DBGET integrated database retrieval system