KEGG   Parageobacillus thermoglucosidasius C56-YS93: Geoth_1680
Entry
Geoth_1680        CDS       T01531                                 

Definition
(GenBank) 2-oxopent-4-enoate hydratase
  KO
K01617  2-oxo-3-hexenedioate decarboxylase [EC:4.1.1.77]
Organism
gth  Parageobacillus thermoglucosidasius C56-YS93
Pathway
gth00362  Benzoate degradation
gth00621  Dioxin degradation
gth00622  Xylene degradation
gth01100  Metabolic pathways
gth01120  Microbial metabolism in diverse environments
gth01220  Degradation of aromatic compounds
Module
gth_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:gth00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Geoth_1680
   00622 Xylene degradation
    Geoth_1680
   00621 Dioxin degradation
    Geoth_1680
Enzymes [BR:gth01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.77  2-oxo-3-hexenedioate decarboxylase
     Geoth_1680
SSDB
Motif
Pfam: FAA_hydrolase
Other DBs
NCBI-ProteinID: AEH47651
UniProt: A0A654KNX3
LinkDB
Position
1602391..1603194
AA seq 267 aa
MLKTEVIDSIVDELFLAEKHGKAIPKLVDRYPGLNVDLAYEVQNRLIERKCRDEGTKVAG
WKLGLTSKAKQEMMGVHEPAYGVLLENMQLQSDGSISLRTLIHPKIEPEIAFIFKEELKG
PGVTVAEVLQKTDYIAPALEIIDSRYQHFSFTLADVIADNSSSSRFILGERFAKYNGEDL
SLVGMVFKKNGAIVSTSAGASVMGHPARAVAWMVNKLSRYGQSVKPGEVVLSGALTGAIE
IEEGDVFSVSLDRFGSVEASFTFGKGE
NT seq 804 nt   +upstreamnt  +downstreamnt
atgctaaaaacggaagttatcgattccatcgtcgatgaattgttccttgccgaaaagcac
gggaaggcgattccgaaactggtcgatcgttatcccggattgaatgttgatcttgcttac
gaagtacaaaaccggttgattgaacgcaaatgccgggacgaagggacgaaagtggccggc
tggaaattggggttgacaagcaaagccaagcaggaaatgatgggggtccatgagccggct
tacggagttttgctggagaatatgcagttgcaaagcgatggctccatttctttaagaaca
ttaatacacccaaaaattgaaccggagattgcctttatttttaaagaggaactaaaagga
ccgggcgttaccgtggcggaagttttgcaaaagacggactacatcgcgccggcgcttgaa
atcattgacagccgctatcaacatttttctttcacgttagcggatgtcattgctgataat
tcttcttcttcccgcttcattttaggagaacgttttgcgaaatataatggggaagattta
agcttagtcggcatggtttttaaaaagaacggcgccattgtttcaacaagcgctggcgca
agcgtgatggggcatccggcaagggccgtcgcctggatggtgaacaaactttcccgttac
ggccaatcagtaaagccaggagaagtcgttctcagcggggcgttaaccggcgcgatagaa
atcgaagaaggagacgtattctccgtgagcttggatcgctttggctcggttgaagcctct
tttaccttcggaaagggggagtaa

DBGET integrated database retrieval system