KEGG   Parageobacillus thermoglucosidasius C56-YS93: Geoth_1821Help
Entry
Geoth_1821        CDS       T01531                                 

Definition
(GenBank) protein of unknown function DUF81
  KO
K07090  uncharacterized protein
Organism
gth  Parageobacillus thermoglucosidasius C56-YS93
Brite
KEGG Orthology (KO) [BR:gth00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Geoth_1821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: AEH47787
LinkDB All DBs
Position
1737665..1738549
Genome map
AA seq 294 aa AA seqDB search
MKKLIVFVIVGFIAQLIDGSLGMAYGVTSTTLLLAFGITPAVASASVHLAEVVTTAASGA
SHIKFGNVDRDMVLKLIVPGSLGAFVGACFLSNLPGDLIKPYVSLFLLALGFYIMYRFLF
LSARQEQQTPRKFSNKQLVPLGLVAGFLDATGGGGWGPISTPVLLANKGIEARKVVGTVD
TSEFAVALSATIGFVISLGWEQVNWFWVGTLMLGGIIAAPIAAWLVRKLPSHLLGVLVGG
LIIFTNARTLLQAWEAPDKWYSAVYSIIVIGWAVSIWLAIRNYRKMSLSNDLAS
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaagttaatcgtattcgtaattgtcggatttatcgcacagcttattgacggttca
cttggaatggcatatggggttacatcaacgacgctgttgcttgcatttggaattactcct
gcggtcgcttctgcttcagtgcatttagcggaagtggtcacaaccgcagcttcgggtgca
tctcatattaaatttggaaatgtcgaccgcgacatggtgcttaaattaattgttcccggt
tcgcttggtgcgtttgtcggcgcctgttttttaagcaatcttccaggcgatctcattaag
ccatatgtttctttatttttattggcgcttggattttacattatgtaccggtttttattc
ctttctgctaggcaagaacaacaaacgccgcggaaattttcgaataagcagcttgtccct
cttggtttagtggccggctttctcgatgcgactggcggtggaggatgggggccgatttcc
actcctgttcttctcgccaacaaaggaatagaagcgagaaaagtcgttgggacggtcgat
acatcggagtttgctgttgctttatccgctaccattggatttgtcatttcattaggctgg
gaacaagtcaattggttttgggtaggaacgcttatgttaggaggcatcatcgctgcgcca
atcgctgcgtggctcgtccgcaagctgccatcccatttgctcggggtattagtcggagga
ttaatcatttttactaatgctcgcacattgctgcaagcatgggaagctcctgacaaatgg
tactcagctgtatacagcatcatcgtgattggttgggcggtttcgatatggctggcaatt
cgcaactaccggaaaatgtcgttatctaatgatctggcgtcataa

DBGET integrated database retrieval system