KEGG   Parageobacillus thermoglucosidasius C56-YS93: Geoth_1943Help
Entry
Geoth_1943        CDS       T01531                                 

Definition
(GenBank) methyl-accepting chemotaxis sensory transducer
  KO
K06595  heam-based aerotactic trancducer
Organism
gth  Parageobacillus thermoglucosidasius C56-YS93
Brite
KEGG Orthology (KO) [BR:gth00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:gth02035]
    Geoth_1943
Bacterial motility proteins [BR:gth02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Geoth_1943
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Protoglobin MCPsignal Transcrip_act UCH APG6_N COG5 T7SS_ESX_EspC Flavodoxin_NdrI DUF1043 DUF948 HAUS-augmin3 OmpH Laminin_II WXG100 AATF-Che1 DUF2730
Motif
Other DBs
NCBI-ProteinID: AEH47902
LinkDB All DBs
Position
1853198..1854490
Genome map
AA seq 430 aa AA seqDB search
MLFKRTKRENSNVNFENGRGDISITKGSEIEKQITMIGLTEKDLHIINAIQPFVIENINF
IVDRFYKNLENELSLLKIINDHSSIEKLKKTLRQHIMEMFNGRVDASFIDKRIKIAHMHV
KIGLPTKWYMCAFQDLFLALMDIIQQNIINKEDCFLAIRAVSKILNLEQQLVLEAYAAES
ERLKEAVEEQKQLVRNNVASASQNLAAISEQTNASFQQLISQSNEIVSLAKNGTKLSLSA
QERAEKGKEHMHKQALIMSNIYSAVDDISNDVHILLEISNQMQEIVGIVTGIADQTNLLS
LNATIEAARAGESGRGFAVVAGEVRNLSEQTKNSVSKVSSLIQNTQKQVEKLTKSLDKIR
TEVKNGNQNMQETEKRFEQILDTMAETMQQNNKIETELISFVNVIDELGKAFEEVSLSAD
KLTMITQELN
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
gtgctcttcaaaagaacaaagcgcgaaaactcaaatgttaattttgaaaacgggagaggc
gatataagtataacgaaaggcagtgaaattgaaaagcaaataacgatgatcggcctgacc
gaaaaagatttacatattattaacgcaatacagccattcgtaatcgaaaacattaatttt
attgtggacaggttttataagaacttggaaaatgaactttcactgttgaaaattattaat
gatcacagttcgatcgagaagttaaaaaagacattaagacaacatattatggaaatgttt
aatggaagagtggatgcctctttcatcgacaaaaggattaaaattgcccatatgcatgtt
aagataggtctgccaacgaaatggtatatgtgtgcatttcaggatttatttttagcactc
atggatattatccaacaaaacatcattaataaggaagattgcttccttgctataagagct
gtctctaaaattttaaatttagaacaacagttagtattagaggcatatgctgctgaatca
gaaagattaaaggaagcagttgaggaacaaaaacagttagttcgtaataatgttgcaagt
gcatcgcaaaatctggcggcaatctcggagcaaaccaatgcttctttccagcaattaatc
tcgcaatcaaacgaaatcgtttctcttgcaaaaaacggaactaagctgtcgctaagcgcg
caagaacgtgccgaaaaaggaaaagaacatatgcataaacaagcattaatcatgtctaac
atttacagtgctgttgatgatatatccaatgatgtccatatattactggaaatatcaaat
caaatgcaagaaatagtcggtattgtcactggaattgctgaccaaaccaacttattatca
ctgaatgcaaccattgaggccgcaagagcaggggaatccggtcgtggttttgctgttgtg
gctggagaagttcgaaatttgtctgagcaaacgaagaactctgtttcaaaagtatcttct
ctaatccaaaatacccaaaaacaagtagagaaactgacaaaatcgcttgacaaaataaga
acagaagtgaaaaatggcaatcaaaacatgcaagaaacagagaaacgattcgagcaaatt
ttagacacaatggcggaaacaatgcagcaaaacaataagatagagacagaattaatatct
tttgtgaatgtgatagatgaattaggaaaagcgtttgaagaggtatctctctctgcagat
aaattaacgatgattacccaagaattgaactaa

DBGET integrated database retrieval system