KEGG   Parageobacillus thermoglucosidasius C56-YS93: Geoth_3589Help
Entry
Geoth_3589        CDS       T01531                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, C subunit
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
gth  Parageobacillus thermoglucosidasius C56-YS93
Pathway
gth00970  Aminoacyl-tRNA biosynthesis
gth01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gth00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Geoth_3589
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:gth03029]
    Geoth_3589
Enzymes [BR:gth01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Geoth_3589
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Geoth_3589
Mitochondrial biogenesis [BR:gth03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Geoth_3589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-ProteinID: AEH49430
LinkDB All DBs
Position
complement(3512909..3513202)
Genome map
AA seq 97 aa AA seqDB search
MMSRISIEQVKHVAHLARLAITDEEAEMFTKQLDAIITFAEQLNELDTENVPPTSHVLDM
KNVMREDVPTPGLPREEVLKNAPDHQDGQFRVPAILE
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcgagaatttccatcgaacaagtcaaacatgtggcgcatttggcgcgtttggcg
attactgacgaagaagcagaaatgtttacgaagcagttagatgcgattattacgtttgct
gagcaattaaatgagctcgatacagaaaacgttccgccaacctcgcacgttttggatatg
aaaaacgtcatgcgcgaagatgtgccgacaccggggcttccgcgcgaagaagtgttgaaa
aacgctccggaccaccaagacgggcaattccgcgtaccagcgattttagagtaa

DBGET integrated database retrieval system