KEGG   Parageobacillus thermoglucosidasius C56-YS93: Geoth_3827
Entry
Geoth_3827        CDS       T01531                                 

Definition
(GenBank) L-iditol 2-dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
gth  Parageobacillus thermoglucosidasius C56-YS93
Pathway
gth00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:gth00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Geoth_3827
Enzymes [BR:gth01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Geoth_3827
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Geoth_3827
    1.1.1.-  
     Geoth_3827
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N ADH_zinc_N_2 2-Hacid_dh_C ADH_N_assoc Orthopox_35kD BRCA2
Other DBs
NCBI-ProteinID: AEH49639
UniProt: A0A654KU72
LinkDB
Position
complement(3761961..3763013)
AA seq 350 aa
MKAARWYNARDIRVEEVEEPKAGKGKVKIKVEWAGICGSDLHEYAAGPIFIPVQNPHPVS
KDVAPIIMGHEFSGRVVEVGEGVTKVKVGDPVVVEPILRCGECPACKKGKYNLCEHLGFH
GLSGGGGGFSEYTVVDEYMVHKMPEGLSFEQGALVEPAAVALHAVRSSKIKPGDKAAVFG
TGPIGLLVMEALKAAGASEIYAVEVSKERLQKAKELGATSVINPKEEDPVRKLVELTGGG
VDVAFEVTGVPAVLQQAIDSTAFEGETVIVSIWEKEAGIQPNNIVLKERNVKGVIAYRDI
FPAVMELMKRGYFQAEKLVTKRIKLDDIVAEGFEALIKEKDQVKILVKPE
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgaaagcagcgcgatggtacaatgctagagacattcgagtggaagaagtagaagaaccg
aaagcaggaaaaggaaaagtaaaaattaaagtcgaatgggcgggaatttgcggaagcgat
ttgcacgaatatgcggcaggtccaatttttatccctgtccaaaatcctcatcccgttagt
aaagatgtcgccccgattatcatgggccacgaattttcgggccgagtagtagaagtcggg
gaaggagttactaaagtcaaagttggggatcctgtcgttgttgaaccgattcttcgttgt
ggagaatgcccggcttgcaaaaaagggaaatacaatctttgcgaacatttaggattccat
ggcctgtccggaggaggcggcggattctcagaatataccgtcgttgatgaatatatggtg
cacaaaatgcctgaaggtctttcttttgaacaaggagcgctggtggaaccggcggctgtc
gcgttacatgctgtcagatcaagcaaaatcaaacctggtgataaagctgccgtttttgga
acaggaccgataggccttcttgtgatggaagcattgaaagcggctggcgcctcggaaatt
tatgcagtcgaagtttccaaagaacgtttgcaaaaagcgaaagagcttggcgccacatct
gtcatcaatccaaaagaagaagatccggttcgcaaacttgtcgaattgaccggtggcggc
gtcgatgttgcgtttgaagtaacgggggtgccggccgttttgcagcaagctattgacagc
actgcattcgaaggagaaacggttatcgttagtatatgggaaaaagaagcaggcattcag
ccaaacaatattgtattaaaagaaagaaatgtgaagggagttattgcataccgcgatatt
ttccctgctgtaatggaattaatgaaacgaggctatttccaagctgaaaagcttgttacg
aaacgaatcaagctggatgatatcgtggcagaaggatttgaagcgctcattaaagaaaaa
gaccaagtgaaaattttggtcaaaccagaataa

DBGET integrated database retrieval system