KEGG   Gluconobacter thailandicus: FXF46_03550Help
Entry
FXF46_03550       CDS       T06199                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
gti  Gluconobacter thailandicus
Brite
KEGG Orthology (KO) [BR:gti00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    FXF46_03550 (ahpF)
Enzymes [BR:gti01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     FXF46_03550 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 HI0933_like Thi4 Glutaredoxin DAO AlaDh_PNT_C FAD_binding_3 NAD_binding_8 HD_4
Motif
Other DBs
NCBI-ProteinID: QEH95431
UniProt: A0A5C0A1F4
LinkDB All DBs
Position
complement(740596..742176)
Genome map
AA seq 526 aa AA seqDB search
MLQDDLKTQMRAYMEYLRSDVVLEATLGSDDRSVEVRGLLEDIASLSDKVTFSDAGTASR
RPSFVICRAGSVEQVTFAGLPMGHEFTSLVLGLLQVSGHPPKIEADLVEQIKALDGDFHF
ETYFSQSCQNCPDVVQALNAMSVLNPKIRHAAIDGADFPEEVERLGIRSVPQVYLNGEPF
ASGRMEVADILAKLDASSVERAAAKLKDVAPFDVLVLGAGPAGASAAIYAARKGLRTGLV
ADRFGGQVMDTAGIENFISVKETEGPQLAGALEAHVRQYDVQIIASQKAAKLVPTKQPGG
LHEIVLESGATLRSKTIILATGARWRQLGVPGEEDYRTKGVAYCPHCDGPFYKGRPVVVT
GGGNSGVEAAIDLANIVSHVTLLQRGAHLKADKVLQDKLLSLPNVTVLMSALTTKIEGDG
KEVTGLTYSDADGGLHHIKTDGVFVQIGLLPNTDWLKGSLDLSPYGEIVINDHCATSVPG
IFAAGDATTVPYKQIVIAMGEGAKASLSAFDYLIRMPAVQKEVELA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgcttcaggacgacctgaaaacccagatgcgcgcctatatggagtacctgcggagcgac
gtcgtgctcgaagccacgcttggctctgacgaccgctctgttgaagtgcgcggattgctg
gaagatattgccagcctgtcagacaaggtgacgttttccgacgccggaacagcatcgcgc
cgcccctccttcgtgatctgccgtgccggttccgtggaacaggtgacgtttgctggcctg
cccatggggcatgagttcacgtctctggttctgggtctgcttcaggtcagtgggcatccg
cccaagatcgaggccgatcttgttgaacagatcaaggcgctggacggggacttccatttc
gagacgtatttctcccagtcctgccagaactgcccggatgtcgtgcaggctctgaacgcc
atgagcgttctgaacccgaagatccgtcatgcggcgattgatggcgcggacttcccggaa
gaagtggaacgtctgggtattcgctccgtgccgcaggtctatctgaacggggagccattc
gcatctggccgtatggaagtcgcggatattcttgccaagctggatgcgtcttctgttgag
cgcgcagctgccaagctgaaggatgtggcaccgtttgatgtgcttgtgctgggcgctggc
cctgccggtgcatcggctgccatctatgcagcgcgtaaaggcctgcggaccggacttgtg
gccgaccgctttggcgggcaggtcatggatactgctgggatcgagaacttcatttccgtg
aaggaaacggaaggtccgcagttggccggagcgctggaagcccatgtgcgccagtatgac
gtgcagattattgcctcccagaaagctgcgaaactggttcccacaaagcagccaggtgga
ttgcacgagattgttctggaaagcggagcgaccctgcggtccaagacgattattctggcg
acaggggcgcgttggcgtcagcttggtgttcctggcgaggaagactatcgcacgaagggc
gtggcgtactgcccgcattgcgacggcccgttctacaagggacgcccggttgtcgtgacg
ggcggcgggaatagtggtgtggaagctgcgattgatctggccaacatcgtgtcccatgtc
acgcttctgcagcgtggtgcgcatctaaaggcggacaaggttttgcaggacaagctgctg
agcctgccaaacgtcacggttctgatgagcgcgctcaccacgaagatcgaaggcgatggc
aaggaagtgaccggcctgacctacagcgatgcggatggcgggctgcatcacatcaagacg
gatggtgtgttcgtgcagatcgggctgctacccaatacggactggctcaagggttctctg
gacctgagtccgtatggtgagatcgttattaacgaccattgtgcgacgtctgtcccgggc
attttcgcggctggtgatgcgacgactgtgccctacaagcagatcgtgattgcgatgggc
gaaggggcgaaggcatctctttccgcctttgattacctgatccgtatgccggccgttcaa
aaggaagttgaactggcctga

DBGET integrated database retrieval system