KEGG   Geobacillus thermoleovorans KCTC 3570: GT3570_01535Help
Entry
GT3570_01535      CDS       T04710                                 

Gene name
gatA
Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
gtk  Geobacillus thermoleovorans KCTC 3570
Pathway
gtk00970  Aminoacyl-tRNA biosynthesis
gtk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gtk00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    GT3570_01535 (gatA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:gtk03029]
    GT3570_01535 (gatA)
Enzymes [BR:gtk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     GT3570_01535 (gatA)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     GT3570_01535 (gatA)
Mitochondrial biogenesis [BR:gtk03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    GT3570_01535 (gatA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AMV09657
UniProt: A0A2Z3N6J0
LinkDB All DBs
Position
281359..282816
Genome map
AA seq 485 aa AA seqDB search
MSLFDHSVSELHTLLKKKEVSISDLVDESYRRIDEVEEKVQAFLTLNEEQARAKAKELDN
QLAKGEETNPLFGLPIGIKDNIVTKGLRTTCASKILYNFDPIYDATVMERLNAAGTITIG
KLNMDEFAMGSSTENSGFQLTRNPWDLERVPGGSSGGSAAAVAAGEVPFALGSDTGGSIR
QPAAFCGVVGLKPTYGRVSRFGLVAFASSLDQIGPITRTVEDNAYVLQAIAGVDPMDSTS
ANIPVPNYVEALTGDIKGLKIAVPKEYLGEGVDEGVRQSVLAALAVLEKLGAAWEEVSLP
HSKYALATYYLLASSEASANLARFDGVRYGYRTDNAKNLIDMYKLTRSEGFGAEVKRRIM
LGTFALSSGYYDAYYKKAQKVRTLIKRDFENVFERYDVIIGPTTPTPAFKIGEKTSDPLT
MYMNDILTIPVNLAGVPAISVPCGFVDGLPVGLQIIGKHFDESTVYRVAHAFEQATDYHK
QKPVL
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctttttgaccattccgtgtcagaattacatacgttgctgaagaaaaaagaagtg
tcgatttccgatttagtcgacgaatcgtaccgccgcatcgatgaagtggaagagaaagtg
caagcgtttttaacattaaatgaagaacaggcgcgggcgaaagcgaaagagttggataac
cagctcgccaaaggcgaagaaacgaacccgctgttcggcttgccgatcggcattaaagac
aacatcgtcacaaaagggctgcgtacgacatgcgccagcaaaattttgtacaactttgac
ccgatttacgacgccactgtcatggagcggttgaatgccgcagggacgatcacgatcggg
aagttgaacatggacgagttcgccatgggctcgtcgacggaaaactccgggtttcagctg
acgcgcaacccgtgggacttagagcgcgttccgggcggctcaagcggcggttcggcggcg
gcggtggcggccggcgaagtgccgtttgctttaggttctgatacgggcggttcgatccgc
cagccggcggcgttttgcggggtcgtcgggttgaaaccgacgtacggacgcgtctcgcgc
ttcgggcttgttgcgtttgcgtcgtcgctggaccaaatcggcccgattacgcgcacggtc
gaagacaacgcgtatgtattgcaagcgatcgcgggcgtcgacccgatggattcgacttca
gcgaacattccagtgccgaactatgtggaggcgttaacgggcgatatcaaagggttgaaa
atcgctgtgccgaaagaatatttaggtgaaggcgtcgatgaaggcgtgcgccagtcagtg
cttgcggcgcttgccgtgcttgagaagcttggcgcggcgtgggaagaagtgtcgctgccg
cattcaaaatacgccttggcgacgtactatttgctcgcttcgtccgaggcatcagcgaac
ttggctcgctttgacggcgtccgctacggctatcggacggacaacgcgaaaaacttgatc
gatatgtataaactgacgcgaagcgaagggtttggggcggaggtcaagcgccgcattatg
ctcgggacgttcgcgttaagctcgggctattacgatgcgtattacaaaaaagcgcaaaaa
gttcggacgttgatcaagcgcgacttcgaaaacgtatttgaacgatatgacgtcatcatc
ggcccgacaacgccgacgccggcgtttaaaatcggcgagaaaacgagtgatccgctgacg
atgtacatgaacgacattttaacgattccagtcaaccttgcgggtgtaccggcgatttct
gtgccgtgcggctttgttgatggcttgccggtcggcttgcaaattatcggcaagcacttt
gatgaaagcaccgtctaccgcgtcgcccacgcttttgaacaagcgaccgactaccataag
caaaaaccggtgttgtaa

DBGET integrated database retrieval system