KEGG   Geobacillus thermoleovorans KCTC 3570: GT3570_06760Help
Entry
GT3570_06760      CDS       T04710                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
gtk  Geobacillus thermoleovorans KCTC 3570
Pathway
gtk00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:gtk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    GT3570_06760
Enzymes [BR:gtk01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     GT3570_06760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC DUF1487
Motif
Other DBs
NCBI-ProteinID: AMV10648
LinkDB All DBs
Position
1349999..1351465
Genome map
AA seq 488 aa AA seqDB search
MKMRTEKQTYLNYINGEWIHSSTGKIEASLNPANIDDIVGYVQESGVEDVNVAVEAARRA
QAAWRKLSGPKRGEYLFRAADVLEKRLDEIAETMTREMGKTLPEAKGEVQRGVNILRYYA
GEGMRSIGEVIPSMDSEALMFTTRVPLGVVGVITPWNFPVAIPIWKIAPAIVYGNTVVFK
PAQETAVTAAKIVECFDQAGLPAGVVNLVTGKGSVIGNAIAEHPHIHGITFTGSNEVGKT
IAQKAVARGAKYQLEMGGKNPVIVLEDADLDRAVEATISGGLRSTGQKCTATSRVFVQSS
IYESFKEQLLAKIKQLKIGDGLKEGVWMGPCASRKQLETILSYIEKGIEEGATLLCGGRR
LVDGELGNGFYIEPTVFENVSPNMTIAREEIFGPVLSLIKVDTFEEALALANDTPFGLSA
SIFTQNIGKMLAFIQDIEAGLVRINEESAGVELQAPFGGMKQSSSHSREQGRAAIEFFTA
IKTVFVKG
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgagaacagaaaaacaaacatacttgaattacatcaatggcgaatggattcat
tcctccactggaaaaatcgaagccagccttaacccagccaacatcgatgatatcgtcggc
tacgttcaagagtccggagtcgaggatgtgaacgttgcggttgaggcggcgcgaagggcg
caggcggcatggcggaagctgtccggcccgaaacgcggagagtatttgttccgcgcggct
gacgttcttgagaaacggcttgacgagatcgccgaaacgatgacaagagaaatgggaaaa
acgctcccggaagcaaaaggggaagtgcagcggggagtcaatattttgcgctactatgct
ggggaggggatgcggtccatcggcgaggtcattccatccatggacagcgaagcgttgatg
tttaccacgcgcgtgcctcttggcgtggttggggtcatcacgccgtggaactttccagtc
gcgattccgatttggaaaatcgcacccgccatcgtctatggaaacaccgttgtgtttaag
ccggcgcaagaaacagctgtcaccgccgcgaaaatcgtggagtgctttgatcaagcgggg
ctgccggccggcgttgtgaatttggtgacaggcaaaggatcggtcatcggcaatgcgatc
gccgaacacccccatattcacggcatcaccttcaccggctccaatgaagtcggcaaaacg
atcgcccaaaaagcggtagcccgaggggcgaaataccagctggaaatgggcggaaagaat
ccggtgatcgtgctcgaggacgctgaccttgatcgcgccgtcgaagcgacgattagcgga
ggactgcgttcgacggggcaaaaatgtacggcgacaagccgtgtcttcgttcagagttcc
atctatgaatcgtttaaagaacaattattagcgaagattaaacagttgaaaattggcgac
ggactgaaagaaggcgtctggatgggcccgtgcgccagccggaagcagttggagacgatt
ctttcttatatcgaaaaagggatcgaagaaggggcgacattgctttgcggcggccgccgc
ttggtcgatggagagctcggaaacgggttttatatagagccgacggtgtttgagaacgta
tccccgaacatgacgatcgctcgcgaggaaattttcgggccggtgctctccttaattaaa
gtggacacgtttgaagaagcgttagccttagccaatgacacaccgtttggccttagcgcc
tcgattttcacgcaaaatatcggcaagatgctcgcgttcatccaagacatcgaggccgga
ctcgtccggattaatgaagaaagcgccggcgtcgaactgcaagcgccgtttggcgggatg
aagcagtccagctcccactcgcgggaacaaggacgggcggccatcgagtttttcacggcg
attaaaacggtgtttgtaaaaggataa

DBGET integrated database retrieval system