KEGG   Geobacillus thermoleovorans KCTC 3570: GT3570_08885Help
Entry
GT3570_08885      CDS       T04710                                 

Definition
(GenBank) nitrite reductase
  KO
K00362  nitrite reductase (NADH) large subunit [EC:1.7.1.15]
Organism
gtk  Geobacillus thermoleovorans KCTC 3570
Pathway
gtk00910  Nitrogen metabolism
gtk01100  Metabolic pathways
gtk01120  Microbial metabolism in diverse environments
Module
gtk_M00530  Dissimilatory nitrate reduction, nitrate => ammonia
Brite
KEGG Orthology (KO) [BR:gtk00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    GT3570_08885
Enzymes [BR:gtk01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.15  nitrite reductase (NADH)
     GT3570_08885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Fer2_BFD NIR_SIR Rubredoxin_C Pyr_redox NIR_SIR_ferr Pyr_redox_3 GIDA AlaDh_PNT_C 3HCDH_N Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: AMV11048
LinkDB All DBs
Position
complement(1772419..1774845)
Genome map
AA seq 808 aa AA seqDB search
MKRKLVLIGNGMAGVRCIEEILKLDREAFEITIFGSEPHPNYNRILLSKVLQGDTRLDDI
TLNSWEWYERNGIRLFAGETVTEVDIKRRLVRTDRGRVVEYDELIFATGSNPFILPVPGA
DLPGVTAFRDIQDCERMIEYAKTYKKAAVIGGGLLGLEAARGLLHLGMDVDVIHIFDYLM
ERQLDPTASKLLQRELEKQGMNVLLRKETAELFGNGRVEGVRFKDGTSIAADLVVMAVGI
RPNVDLARRSGIEVNRGIVVNDYLETSVPHIYAVGECAEHRGVVYGLVAPLYEQGKVLAE
AICGRKGKPYEGSVVATQLKVSGVDVFSAGEFMDGEGTESIKLYDEARSVYKKVVVRQGK
IVGAVLFGDTSEGRKLFDMIQRGDSVEALSLSLFAPAALGGKGSLAAAMADTDVVCGCNG
VTKGAICQAIAEHGLKTVAEVRDYTNASRSCGGCKGLVAELLEHMLGEEANRYTVKETIC
GCTDLSREEVLEAIEQRRLMTVKEVMSVLGWKNEEGCSKCRPALNYYLGMLYPGEYDEEA
ESLFVNERLHANIQADGTYSVVPRIYGGVTTAEQLRNIADVAEKYNVPMIKITGGQRIDL
LGVKKEDLPRIWADLGMPSGYAYAKALRTVKTCVGKQFCRFGTQDSTGLGIRMEQTFERL
KTPHKVKMAVSACPRNCAESGIKDVGIVGVEGGWEIYVGGNGGTHLRAADLLCTVKTEDE
VIEMTGAFLQYYRESAHYLERTSKWVERVGLEHIREVLFDVETRRALLERLHKALSATTD
PWRDIVENERLQQLLFRDIGDKEPVSVE
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaaaactcgtgttaatcggcaacggcatggcgggggttcgctgcatcgaggag
attttaaaacttgaccgcgaggcgtttgagatcacgatttttggcagcgaaccgcatccg
aattataaccgcattttgttgtcgaaggtgctgcaaggagatacgcgccttgatgacatt
acgttgaacagttgggaatggtacgaacgaaacggcattcggctgtttgccggcgaaacg
gtgacggaagtcgacatcaagcggcggcttgttcggaccgaccgtgggcgggtagtcgaa
tacgatgaattgattttcgcgacagggtcgaatccgtttatcttgccggtgccgggggcg
gatttgcccggggtgacggcgtttcgcgatatccaagattgcgagcggatgatcgaatat
gcgaagacgtacaaaaaagcggcggtcattggcggcggcttgcttggcttggaggcggcg
cgcggcctgcttcacttaggaatggatgtcgatgtcatccatattttcgactatttgatg
gaacgccagcttgatccgaccgcttccaagctgctgcagcgggagctggagaaacaaggg
atgaacgttttgcttcgcaaggagacggccgaattgttcggcaacggccgtgtggaagga
gtgcgatttaaggacggtacgtccattgccgccgacttggtggtgatggcggtcggtatt
cgtccgaatgttgatttagcgcggagaagcggcattgaagtgaatcgagggatcgttgtc
aatgactacttggaaacgagtgtgccgcacatttacgcggtcggtgaatgcgcggaacat
cgcggtgttgtgtatggactcgtcgctccgctttatgaacaggggaaagtgctggcagag
gcgatttgcggccgaaaaggaaagccgtatgaaggatctgtcgttgcgactcagctgaaa
gtgtccggtgtcgacgtgttctcggctggtgaatttatggatggcgaagggacggagtcg
atcaaactgtatgacgaagcgcgctcggtgtacaagaaagtcgtcgttcgccaagggaaa
atcgttggggcggtgctgtttggcgatacgagcgaaggtcgaaagctgttcgatatgatc
cagcgcggcgattcggttgaggcgctctcgctgtcgctgtttgccccagccgctttaggc
gggaagggaagccttgcggcggcgatggccgacaccgatgttgtttgcggctgcaacggg
gtgacaaaaggcgcgatttgtcaggcgattgccgaacacgggcttaagacggtcgccgag
gtgcgcgactatacgaacgcgtcccgctcatgcggcgggtgtaaagggcttgtcgccgag
ctgcttgagcatatgctcggtgaagaagcgaatcggtatacggtgaaagaaacgatctgc
ggctgcacggacctaagccgtgaggaagtgctcgaggccatcgaacaaagacggttgatg
acggtcaaagaagtcatgagcgtattgggatggaaaaacgaggaaggctgttccaaatgc
cgtccggcgctcaattattacctgggcatgctttatccgggtgagtacgatgaagaagcg
gaatctttgtttgtcaatgaacggctgcacgccaacatccaggccgatggcacgtactcc
gttgtgccgcgcatatacggcggggtgaccacagccgagcagctgcggaacatcgccgat
gtcgcggaaaaatacaacgtgccgatgattaagatcacaggcgggcagcgcatcgacttg
cttggggtgaaaaaagaagatttgccgcgcatttgggccgatctcggcatgccgtcaggc
tacgcctacgccaaggcgctgcggacggtgaaaacgtgcgtcggcaagcagttttgccgc
tttggcacgcaagattcaaccgggcttggcattcggatggaacaaacatttgagcggctg
aaaacgccgcataaagtgaaaatggccgtctccgcctgcccgcgcaactgcgcggaatcg
ggcattaaagatgtcggcatcgtcggcgtcgagggcggatgggagatttatgtcggcggc
aacggcggcacccatttgcgtgcagctgacttgctttgcacggtcaagacggaagacgag
gtgatcgagatgaccggcgcttttttgcaatattaccgcgagtccgcgcattatttggaa
cggacgtccaaatgggtcgagcgcgttgggcttgagcatatccgcgaagtgttgttcgat
gtggaaacgcgccgcgcgctgcttgagcggcttcacaaagctctttcggcgacaacagat
ccgtggcgggacattgtcgaaaacgagagactgcagcaactgttgttccgcgatatcggc
gacaaagagccggtgtcggtggaatga

DBGET integrated database retrieval system