KEGG   Geobacillus thermoleovorans KCTC 3570: GT3570_12615Help
Entry
GT3570_12615      CDS       T04710                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
gtk  Geobacillus thermoleovorans KCTC 3570
Brite
KEGG Orthology (KO) [BR:gtk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    GT3570_12615
Enzymes [BR:gtk01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     GT3570_12615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_binding_2 DAO FAD_oxidored AlaDh_PNT_C Thioredoxin_4 NAD_binding_7 FAD_binding_3 Glutaredoxin Thi4 NAD_binding_8 FMO-like K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AMV11765
UniProt: A0A1C3D692
LinkDB All DBs
Position
complement(2486131..2487660)
Genome map
AA seq 509 aa AA seqDB search
MLLDADIKAQLAQYLQLLENDIVLTVSAGDDNVSRDMLALIDELTAMSSKIKVEKAKLER
TPSFSVNRVGENTGITFAGVPLGHEFTSLVLALLQVSGRPPKVSQDVVDRIQQIRGKHHF
ETYVSLTCHNCPDVVQALNIMSVLNPDISHTMIDGAAFKEEAEQKGIMAVPTVFLNGKLF
ASGRMSLEDILAKLGSAPDASSFADKEPFDVLVIGGGPAGATAAIYAARKGIRTGIVAER
FGGQILDTLGIENFISVKYTEGPKLAASIEEHVKQYNVDIMNSQRAKRLEKKDLIEVELE
NGAVLKSKTVVIATGARWRNLGVPGEEEFKNKGVAYCPHCDGPLFEGKHVAVIGGGNSGV
EAAIDLAGIASHVTLLEFAPELKADAVLQDRLYSLPNVTVIKNAQTTEITGTDKVNGLTY
IDRETGEEHHIELQGVFVQIGLVPNTEWLEGTVERNRFGEIIVDKRGATNIEGVFAAGDC
TDSAYKQIIISMGSGATAALSAFDYLIRH
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgctgctggatgctgacatcaaggcgcaactagcccagtatttgcaattgcttgaaaat
gatattgtcttgacggtaagcgcgggagacgacaacgtttcccgcgatatgcttgcttta
atcgatgaattaacggcgatgtcgtcgaaaatcaaagtggaaaaagcgaagctggaacga
acgccaagcttcagcgtcaaccgggtcggcgaaaacaccggcatcaccttcgccggcgtg
ccgctcggccatgaatttacgtccctcgttttggcgctgcttcaagtgagcgggcggccg
ccgaaagtcagccaagacgtcgtggaccgcattcaacaaatcagaggcaaacatcatttt
gaaacgtacgtcagcctgacctgccacaactgcccggacgtcgtccaagcgctcaacatc
atgagcgtgttgaacccagacatttcgcatacgatgatcgacggggcggcgtttaaagaa
gaagcggagcaaaaagggattatggccgtaccgacggtgtttttaaacggcaaactgttc
gcgagcggccgcatgtcgcttgaagatatcctcgccaaattagggagtgctccggatgct
tcttcctttgctgacaaagagccgttcgacgtgttggtgatcggcggcggccctgcgggt
gcgacagcagccatttacgcagcgcgcaaaggcattcgcactgggattgttgcggagcgc
ttcggtggacaaattttagatacgctcggcattgaaaactttatcagcgtcaaatatacg
gaaggaccgaagcttgcggccagcattgaggaacatgtgaagcaatacaacgtcgacatc
atgaactcgcagcgggcaaaacgactcgagaaaaaagacttgattgaagtcgagttggaa
aacggcgccgtgttgaaaagcaaaacggttgtgatcgcaacgggcgcccgttggcgcaac
cttggcgtgccgggcgaggaagagttcaaaaacaaaggggtcgcctattgcccgcattgc
gatggcccgctgttcgaagggaagcacgtggcggtcatcggcggcgggaactctggagtc
gaagcggcgattgacctcgctggcatcgccagccatgtgacgctgcttgagttcgcccct
gaactcaaggccgatgctgttttgcaagatcgtttgtacagcttgccgaacgtaacggtg
attaaaaacgcgcaaacgacggaaatcaccggcacggacaaagtcaacggcttgacgtac
attgaccgggaaacaggggaagaacatcatatcgaattgcaaggcgtgttcgtgcaaatc
ggccttgttccgaacaccgaatggttggaaggaacggtggaacggaatcgcttcggtgaa
attatcgtcgataaacgcggcgcgacgaacattgaaggcgtctttgccgcgggcgactgc
acggacagcgcctataagcaaatcattatttcgatgggctcgggtgcaaccgcagcgtta
agcgcgtttgattatttgattcgccattaa

DBGET integrated database retrieval system