KEGG   Geobacillus thermoleovorans KCTC 3570: GT3570_13435Help
Entry
GT3570_13435      CDS       T04710                                 

Definition
(GenBank) ATP-dependent 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gtk  Geobacillus thermoleovorans KCTC 3570
Pathway
gtk00010  Glycolysis / Gluconeogenesis
gtk00030  Pentose phosphate pathway
gtk00051  Fructose and mannose metabolism
gtk00052  Galactose metabolism
gtk00680  Methane metabolism
gtk01100  Metabolic pathways
gtk01110  Biosynthesis of secondary metabolites
gtk01120  Microbial metabolism in diverse environments
gtk01130  Biosynthesis of antibiotics
gtk01200  Carbon metabolism
gtk01230  Biosynthesis of amino acids
gtk03018  RNA degradation
Module
gtk_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
gtk_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:gtk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GT3570_13435
   00030 Pentose phosphate pathway
    GT3570_13435
   00051 Fructose and mannose metabolism
    GT3570_13435
   00052 Galactose metabolism
    GT3570_13435
  Energy metabolism
   00680 Methane metabolism
    GT3570_13435
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    GT3570_13435
Enzymes [BR:gtk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     GT3570_13435
Protein phosphatases and associated proteins [BR:gtk01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     GT3570_13435
Messenger RNA biogenesis [BR:gtk03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     GT3570_13435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK Peripla_BP_1 NAD_kinase PucR
Motif
Other DBs
NCBI-ProteinID: AMV11929
UniProt: A0A1C3DAU8
LinkDB All DBs
Position
complement(2657372..2658331)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAIRAVVRKAIYHGVEVYGIYHGYAGLIAGNIKKLEVGDVGDI
IHRGGTILYTARCPEFKTEEGQKKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEHGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVVEVMGRHAGDIALWS
GLAGGAETILIPEADYDMDDIIARLKRGHERGKKHSIIIVAEGVGSGVDFGRQIQEATGF
ETRVTVLGHVQRGGSPTAFDRVLASRLGARAVELLLEGKGGRCVGIQNNQIVDHDIAEAL
AKTHTVDQRMYTLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggattggtgtgttgacaagcggcggcgactcgccgggcatgaatgcggccatt
cgcgctgtcgtccgcaaagcgatttaccatggggtggaagtgtacggaatctaccacggg
tatgccgggttgatcgccggcaatatcaaaaagctggaagtcggggacgtcggggacatc
atccatcgcggcggcaccatcctttataccgcgcgctgcccggagtttaagacggaagaa
ggacagaaaaaggggatcgagcagctgaaaaagcacggcattgaagggctggtcgtcatc
ggcggcgacgggtcgtatcaaggggcgaaaaaattgacggagcacggcttcccgtgcgtc
ggcgtgcccgggacgatcgacaacgacattccaggcaccgattttacgatcggttttgac
accgcgctcaatacggtcattgacgccattgacaaaatccgcgacacggcgacgtcgcat
gagcggacgtacgtcgtcgaagtgatgggccgccatgccggcgatattgcgctatggtcg
gggcttgccggaggggcggagacgattttgattccggaagcggactacgacatggacgac
atcatcgctcgcttgaagcgcggccatgaacgcggcaaaaaacacagcatcatcatcgtc
gccgagggagtcggcagcggcgtcgacttcggccggcaaattcaagaggcgaccggcttt
gagacgcgcgtgacggtgcttggccacgtgcagcgcggcggatcgccgacggcgtttgac
cgcgtgttagcgagccgcctcggcgcccgtgcggtcgagctgctccttgaaggcaaaggc
ggccgctgcgttggcattcaaaacaaccaaatcgttgaccatgacattgccgaagcgttg
gcgaaaacacatacggtcgatcagcggatgtatacattgtcgaaagagctgtcgatttaa

DBGET integrated database retrieval system