KEGG   Geobacillus thermoleovorans KCTC 3570: GT3570_15685Help
Entry
GT3570_15685      CDS       T04710                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
gtk  Geobacillus thermoleovorans KCTC 3570
Pathway
gtk00010  Glycolysis / Gluconeogenesis
gtk00620  Pyruvate metabolism
gtk01100  Metabolic pathways
gtk01110  Biosynthesis of secondary metabolites
gtk01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gtk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GT3570_15685
   00620 Pyruvate metabolism
    GT3570_15685
Enzymes [BR:gtk01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     GT3570_15685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: AMV12354
LinkDB All DBs
Position
3107688..3109208
Genome map
AA seq 506 aa AA seqDB search
MIYAQPGQPGALVTFKKRYENFIGGKWVPPVDGEYFENITPITGQPYCEVPRSKAADIEL
ALDAAHAAKDAWGRTSPAERARLLNKIADRMEENLEMLAVAETWENGKPIRETLAADIPL
AIDHFRYFASCIRAQEGTISEIDHDTVAYHFKEPLGVVGQIIPWNFPILMAAWKLAPALA
AGNCVVLKPAEQTPTSILVLIELIEDLLPPGVVNVVNGFGLEAGKPLASNPRVAKVAFTG
ETTTGRLIMQYASQNIVPVTLELGGKSPNIFFADVMDKDDEFLDKALEGFTMFALNQGEV
CTCPSRALIHESIYDAFMERALERVKQIKQGNPLDTETMIGAQASSEQLEKILSYIDIGK
QEGAELLIGGERNMLEGELSGGYYVKPTIFKGHNKMRIFQEEIFGPVLAVTTFKDHDEAL
SIANETLYGLGAGVWTRDINTAYRFGRGIQAGRVWTNCYHIYPAHAAFGGYKMSGIGRET
HKMMLDHYQQTKNLLVSYSPKKLGLF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgatctacgcacaaccaggccagccaggcgcgcttgtcacatttaaaaagcgctacgaa
aacttcattggcggcaaatgggtgccgccggtcgacggcgagtatttcgaaaatatcacg
ccaatcaccggacagccgtattgcgaagtgccgcgctcaaaagcggcggacatcgaactg
gcgcttgacgccgcccatgcggcaaaagacgcatggggacgcacgtctccagcggagcgc
gcccgtttgttgaacaaaatcgccgaccggatggaagaaaacttggaaatgctcgccgtt
gcggaaacatgggaaaacggcaagccgatccgcgaaacgttggcggctgacatcccgctt
gccatcgaccatttccgctacttcgccagctgcattcgcgcgcaagaaggcacgatttcg
gaaatcgatcacgacacggtcgcctatcatttcaaagaaccgctcggcgtcgtcgggcaa
atcatcccgtggaacttcccgattttaatggcggcctggaaactcgcgccagcgctcgcg
gccggcaactgcgtcgtgttgaaaccggcggagcaaacgccgacgtcgatcctcgttctc
atcgaactcatcgaagatttgcttccgcctggcgtcgtcaacgttgtgaacggctttggc
ttagaagccggcaagccgctcgcctcgaatccacgcgtggcgaaagtggcgttcaccggt
gaaacgacgaccggacggctcatcatgcagtacgcctcgcaaaacatcgtgccggtcacg
cttgagcttggcggcaagtccccgaacattttcttcgctgatgtgatggacaaagatgac
gagtttctcgataaagccctcgaagggtttacgatgttcgctctaaaccaaggcgaagtg
tgcacatgcccgtcgcgcgccctcatccacgagtcgatttacgatgcctttatggaacgg
gcgcttgaacgcgtcaagcaaatcaagcaaggcaatccgctcgatacggaaacaatgatc
ggcgcccaagcctcgtccgagcagctcgagaaaattttgtcatacatcgacatcggcaaa
caggaaggcgccgaacttttgatcggcggcgaacggaacatgctggaaggggaactctcc
ggcggatactatgtcaagccgacgattttcaaaggacataacaaaatgcgcatcttccaa
gaagaaattttcggcccggtgctcgcggtcacgacgtttaaagatcacgacgaagcgctt
tcgatcgccaatgagacgctgtacggccttggcgccggcgtctggacgcgcgacatcaac
accgcgtaccggttcggccgcggcatccaggccggccgcgtgtggacgaactgctatcac
atttatccggcccatgcggcatttggcggctacaagatgtccggcatcggccgcgaaacg
cacaaaatgatgctcgaccattaccaacaaacgaaaaacttgctcgtcagctattcgccg
aaaaaacttggcttgttctga

DBGET integrated database retrieval system