KEGG   Geobacillus thermocatenulatus: GT3921_00260Help
Entry
GT3921_00260      CDS       T05178                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
gtm  Geobacillus thermocatenulatus
Pathway
gtm00473  D-Alanine metabolism
gtm01100  Metabolic pathways
gtm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:gtm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    GT3921_00260
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    GT3921_00260
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gtm01011]
    GT3921_00260
Enzymes [BR:gtm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     GT3921_00260
Peptidoglycan biosynthesis and degradation proteins [BR:gtm01011]
 Precursor biosynthesis
  Racemase
   GT3921_00260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ASS97649
UniProt: A0A226Q419
LinkDB All DBs
Position
complement(48522..49676)
Genome map
AA seq 384 aa AA seqDB search
MDEFHRDTWVEIDLDAIYDNVVNLRRFLPEGTQIMAVVKANAYGHGDVQVAATALEAGAS
RLAVAFLDEALALRKKGIDAPILVLGASRPEDVALAAEHRIALTVFRSDWLEKASSLYNG
STPIHFHLKMDTGMGRLGVKDEEETKRIAALIDRHPPFVLEGVYTHFATADEVNTDYFSY
QYARFLHMLDWLPSRPPLVHCANSAAALRFSDRAFNMVRFGISMYGLAPSPDIKPLLPYE
LKEAFSLHSRLVHIKKLRPGEKVSYGATYTAQTEEWIGTIPIGYADGWLRRLQHFHVLVG
GQRAPIVGRICMDQCMIRLPGPLPVGTKVTLIGRQGDEVISIDDVARHLDTINYEVPCTI
SYRVPRIFFRNKRIMEVRNAVGRG
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggacgagtttcaccgcgatacgtgggtggaaattgatttggatgccatttacgacaac
gtcgtgaatttgcgccgctttttgccggagggtacgcaaattatggccgttgtcaaggcg
aacgcctacgggcacggcgatgtccaagtggcggcaacggcgcttgaagcgggcgcttcc
cgcttggccgtcgcctttttggacgaggcgcttgccttacgaaaaaaaggcatcgatgcc
ccgattttagtgcttggagcgtctcgtcccgaggatgtggcgttggccgccgaacaccgc
atcgccttaaccgtatttcgctctgattggctcgagaaggcgtcatcgctgtataacggt
tcgaccccgattcatttccatttaaagatggacacaggaatgggacggcttggggtgaaa
gacgaagaggagacaaagcgaatagcggccttgatcgatcgccatccgccctttgtgctt
gaaggggtgtatacgcattttgcgaccgctgatgaagtaaatacggattacttttcttat
caatacgcccgctttttgcatatgcttgactggctgccgtcgcggccgccgctcgttcat
tgcgccaacagcgcggcggcccttcgtttttccgatcgagcgtttaacatggttcgcttt
ggcatttcgatgtacgggctcgccccatcgccggacatcaagccgctcctcccatacgaa
ttgaaagaggcattttcgctccatagccgcctcgtacacatcaaaaaactgcgaccaggg
gaaaaggtgagctacggtgcgacgtacaccgcgcagacggaagagtggatcggcacgatc
ccaatcggttatgcggacggctggctgcgaaggttgcagcactttcatgtgcttgttggc
gggcagcgggcgccgatcgtcggccgcatttgcatggaccaatgcatgatccgcctgcct
gggccgctgcctgtcgggacgaaggtgacattaattggccgccaaggggacgaagtcatt
tccattgatgatgtcgcccgccatttggacacaatcaattatgaagtgccgtgcacgatc
agctaccgggtgccccgtatttttttccgaaataagcgtataatggaagtgagaaacgcc
gttggccgcggatga

DBGET integrated database retrieval system