KEGG   Geobacillus thermocatenulatus: GT3921_00295Help
Entry
GT3921_00295      CDS       T05178                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
gtm  Geobacillus thermocatenulatus
Pathway
gtm00473  D-Alanine metabolism
gtm00550  Peptidoglycan biosynthesis
gtm01100  Metabolic pathways
gtm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:gtm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    GT3921_00295
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    GT3921_00295
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    GT3921_00295
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gtm01011]
    GT3921_00295
Enzymes [BR:gtm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     GT3921_00295
Peptidoglycan biosynthesis and degradation proteins [BR:gtm01011]
 Precursor biosynthesis
  Amino acid ligase
   GT3921_00295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST GARS_A
Motif
Other DBs
NCBI-ProteinID: ASS97656
UniProt: A0A226Q641
LinkDB All DBs
Position
complement(55231..56334)
Genome map
AA seq 367 aa AA seqDB search
MKTRVGVLYGGKSPEHQVSLSTAMAVMNAIDPHKFDVIPIYITPEGQWIKGEQLTGPIEE
IKQLQFTSAATALIPVSLNQVPAADSAAAGNEEMIDVIFPLLHGPNGEDGTVQGLLEILN
IPYVGNGVLASAVGMDKVMMKNLFAQAGLRQAKYIAVTKYDWQKSGETVYDRIEQELGYP
CFVKPANAGSSVGISKCKQRGDLKAAFIEAFQYDRKIIIEEAIVGREIEIGVIGNDEPIC
SVVGEIVPKKEFYDYEAKYEDGQTELIIPADVTKEQYETIKQMAITAFQALDLSGLARVD
FFLAEDCAVYINEVNTMPGFTPYSMFPLLWQHSGVPYPELIERLIALALERHQEKQTITY
TFKKEKR
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgagagttggcgtgttatacggcggcaaatcaccggagcaccaagtatcgttg
tcgacggcgatggcggtgatgaacgccattgatcctcataaattcgatgtcattccgatt
tatattacaccggaaggtcaatggatcaagggcgaacaactgaccggaccgatcgaggaa
atcaagcagctgcaattcacttcggcggcgaccgccttgataccggtttccttgaaccaa
gttccggctgccgattcggctgcggcaggaaacgaggaaatgatcgatgtcattttcccg
cttttgcatgggccgaacggcgaagacggaacggtgcaagggttgcttgagatattgaac
attccgtatgtcggcaacggggtgcttgcttccgcggtcggcatggataaggtgatgatg
aaaaacttgtttgcgcaggccgggttgcgccaagcaaaatatatcgccgtgacgaagtac
gattggcaaaaaagcggcgaaacggtgtatgaccggatcgaacaagagcttggctacccg
tgctttgtcaagccagccaacgccggttcgagcgtcggcatttccaaatgcaagcagcgc
ggcgatttaaaagccgcatttatcgaggcatttcagtatgaccgaaaaattattattgaa
gaggcgattgtcggccgcgaaattgaaatcggcgtgatcggaaatgatgagccgatttgt
tcggtcgttggcgaaattgttcccaaaaaggaattttatgactatgaagcgaaatacgaa
gacgggcaaaccgaattgatcatcccagcggacgtaacgaaagaacagtatgagacgatc
aaacaaatggccattacggcgtttcaggcgctggatttgtctggacttgcgcgcgtcgat
tttttcctcgccgaagattgcgctgtttatatcaacgaagtgaacacgatgccaggcttt
acgccatacagcatgttcccgcttctttggcagcacagcggtgtgccgtacccggagctg
attgaacggcttatcgcgctcgcattggaacgacatcaagaaaagcagacgatcacgtac
acgttcaaaaaagaaaagaggtga

DBGET integrated database retrieval system