KEGG   Geobacillus thermocatenulatus: GT3921_02945Help
Entry
GT3921_02945      CDS       T05178                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
gtm  Geobacillus thermocatenulatus
Pathway
gtm00010  Glycolysis / Gluconeogenesis
gtm00620  Pyruvate metabolism
gtm01100  Metabolic pathways
gtm01110  Biosynthesis of secondary metabolites
gtm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gtm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GT3921_02945
   00620 Pyruvate metabolism
    GT3921_02945
Enzymes [BR:gtm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     GT3921_02945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: ASS98101
UniProt: A0A226Q8X1
LinkDB All DBs
Position
complement(588323..589843)
Genome map
AA seq 506 aa AA seqDB search
MIYAQPGQPGALVTLKKRYENFIGGKWVPPVDGEYFENITPITGQPYCEVPRSKAADIEL
ALDAAHAAKDAWGRTSPAERARLLNKIADRMEEHLEMLAVAETWENGKPIRETLAADIPL
AIDHFRYFASCIRAQEGTISEIDHDTVAYHFKEPLGVVGQIIPWNFPILMAAWKLAPALA
AGNCVVLKPAEQTPTSILVLIELIEDLLPPGVVNVVNGFGLEAGKPLASNPRVAKVAFTG
ETTTRRLIMQYASQNIVPVTLELGGKSPNIFFADVMDNNDEFLDKALEGFTMFALNQGEV
CTCPSRALIHESIYDAFMERALERVKQIKQGNPLDTETMIGAQASSEQLEKILSYIDIGK
QEGAELLIGGERNMLEGELAGGYYVKPTIFKGHNKMRIFQEEIFGPVLAVTTFKDHDEAL
AIANETLYGLGAGVWTRDINTAYRFGRGIQAGRVWTNCYHVYPAHAAFGGYKMSGIGRET
HKMMLDHYQQTKNLLVSYSPKKLGLF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgatttacgcacaaccaggccagccaggcgcgcttgtcacattgaaaaagcgctacgaa
aacttcattggcggcaaatgggtgccgccggtcgacggcgagtattttgaaaacatcacg
cccatcaccggacagccgtattgcgaagtgccgcgctccaaagcggcggacatcgaactg
gcgcttgacgccgcccacgcggccaaagacgcctggggacgcacgtctccagcggagcgc
gcccgtttgctgaacaaaatcgccgatcggatggaagaacatttggaaatgctggccgtc
gccgaaacgtgggaaaacggcaagccgatccgcgagacgctcgcggctgacattccgctt
gccatcgaccatttccgctattttgccagctgcatccgcgcgcaagaaggcacgatttca
gaaatcgatcacgacacggtcgcctatcatttcaaagaaccgctcggcgtcgtcgggcaa
atcatcccgtggaacttcccgattctcatggcggcgtggaaacttgcgccagcgctcgca
gccggcaactgcgtcgtcttgaaaccggcagagcaaacaccgacatcgatcctcgtcctc
atcgaactcatcgaagatttgcttccacctggtgtcgtcaacgttgtgaacggctttggc
ttagaagccggcaagccgctcgcctcgaacccgcgcgtggcgaaagtggcgttcaccggt
gaaacgacgaccagacggctcatcatgcagtacgcctcgcaaaacatcgtgccggtcacg
cttgagcttggcggcaagtccccgaacattttcttcgctgatgtgatggacaacaatgac
gagtttctcgataaggcgcttgaagggtttacgatgttcgctctgaaccaaggcgaagtg
tgcacatgcccgtcgcgcgccctcatccatgagtcgatttacgacgcttttatggaacgg
gcgcttgaacgcgtcaaacaaattaaacaaggcaacccgcttgacaccgaaacgatgatc
ggcgcccaagcctcctctgaacagctcgagaaaattttgtcatacatcgacatcggcaaa
caggaaggcgccgaacttttgatcggcggggaacggaacatgctggaaggggagctcgca
ggcggctattacgtcaagccgacgattttcaaaggacataacaagatgcgcatcttccaa
gaagaaattttcggtcccgttttagccgtcaccacctttaaagaccatgatgaagcgctt
gccatcgccaatgagacgctgtacggccttggcgccggcgtctggacgcgcgacatcaac
accgcgtaccgcttcggccgcggcatccaagccggccgcgtctggacgaactgctaccac
gtctatccggcccatgcggcgttcggcggctacaagatgtccggcatcggccgtgaaacg
cacaaaatgatgcttgaccattaccaacaaacgaaaaacttgctcgtgagctattcaccg
aaaaaactgggcttgttctaa

DBGET integrated database retrieval system