KEGG   Geobacillus thermocatenulatus: GT3921_03340Help
Entry
GT3921_03340      CDS       T05178                                 

Definition
(GenBank) histidine kinase
  KO
K07777  two-component system, NarL family, sensor histidine kinase DegS [EC:2.7.13.3]
Organism
gtm  Geobacillus thermocatenulatus
Pathway
gtm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:gtm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    GT3921_03340
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gtm01001]
    GT3921_03340
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:gtm02022]
    GT3921_03340
Enzymes [BR:gtm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     GT3921_03340
Protein kinases [BR:gtm01001]
 Histidine kinases
  NarL family
   GT3921_03340
Two-component system [BR:gtm02022]
 NarL family
  DegS-DegU (multicellular behavior control)
   GT3921_03340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DegS HisKA_3 HATPase_c HATPase_c_2 HATPase_c_3 T3SSipB YabA DUF2120 DDHD Dna2 HD_assoc
Motif
Other DBs
NCBI-ProteinID: ASS98168
UniProt: A0A226Q8Z3
LinkDB All DBs
Position
676105..677286
Genome map
AA seq 393 aa AA seqDB search
MAEAKHWDVKQLDRIVEKMIDTVQHSKDEIFRIGEQSRQEHDHLLRELEEVKRLTVQAIE
EADQLDRKARQARRRLSEVSQNFSTHSEQDIREAYEAAHELHMKLTMVREREKQLRLRRD
ELERRLASLALIIERADYLVGQITVVLHYLNSDFRQVGELIEGAKQKQEFGLKIIEAQEE
ERRRLSREIHDGPAQLLAHVLLRSDLVEKVIKERGTEAAIAEIRDFRKMVRSALSEVRRI
IYDLRPMALDDLGLVPTLKKYLQTTEEYNNGVHISFVHIGEEIRLPSRMEAAVFRLVQES
VQNALKHAEARHIDVKMEVTCRHLLVSVKDDGKGFDPSVKKENAFGLIGMRERVELLGGT
LDIRSKIGSGTTVFIRVPLDRSTDETNKEERKR
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagcaaagcattgggacgtgaagcagttagatcggattgtcgaaaaaatgatc
gacaccgttcaacatagcaaagacgaaatttttcgcatcggggagcagtcgcgtcaagag
cacgaccatttgctgcgcgaacttgaggaggtgaaacggctgaccgtgcaggcgatcgaa
gaagcggatcagctggataggaaggcgcgtcaagcgcgccgccgcctgtcggaagtgagc
caaaacttttccacccactcggagcaagatattcgcgaggcgtatgaagcggcgcatgag
ctgcatatgaagctgacgatggtgcgggagcgggagaaacagctgcggctgcgccgcgac
gagctggagcggagattggcaagtcttgcgctaattatcgaacgtgccgattatttagtt
ggacaaattacggtcgtgctccactacttaaacagcgatttccgccaggtcggcgagctg
attgaaggtgcgaagcaaaaacaggaatttggactgaaaatcatcgaagcccaggaagaa
gagcggcgtcggctgtcgcgggaaatccatgacggtccggcgcagctgcttgcgcatgtc
ctgcttcgatcggatctcgtcgaaaaggtgatcaaagagcgagggacagaggcggcgatc
gccgaaattcgcgattttcgcaaaatggtgcgttcggctttgtccgaagtgcgccgcatc
atttacgatttgcggccgatggcgcttgatgatttaggattggtgccaacgctaaaaaaa
tatttgcaaacgaccgaagaatataataacggagtccatatttcctttgtgcatatcggc
gaagaaattcggctgccgtcgcggatggaggcggccgtgtttcggcttgtccaagagtcg
gtgcaaaatgccttaaagcacgccgaagcgcgccacatcgacgtcaaaatggaagtgacg
tgccgccatctgcttgttagcgtcaaggacgatggcaaaggatttgatccatcggtcaaa
aaagaaaatgcgttcggcttgattggcatgcgggagcgggtggagctgctcggcggcacg
ctcgacatccgctcaaagattggcagcggaacgaccgtgttcattcgcgttccgctcgac
cgttcgactgacgaaacgaacaaggaggagaggaaacgatga

DBGET integrated database retrieval system