KEGG   Geobacillus thermocatenulatus: GT3921_03345Help
Entry
GT3921_03345      CDS       T05178                                 

Definition
(GenBank) DNA-binding response regulator
  KO
K07692  two-component system, NarL family, response regulator DegU
Organism
gtm  Geobacillus thermocatenulatus
Pathway
gtm02020  Two-component system
gtm02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:gtm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    GT3921_03345
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    GT3921_03345
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:gtm02022]
    GT3921_03345
Two-component system [BR:gtm02022]
 NarL family
  DegS-DegU (multicellular behavior control)
   GT3921_03345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg GerE Sigma70_r4_2 HTH_23 Sigma70_r4 HTH_38 CAMSAP_CH
Motif
Other DBs
NCBI-ProteinID: ASS98169
UniProt: A0A226QB97
LinkDB All DBs
Position
677283..677957
Genome map
AA seq 224 aa AA seqDB search
MKTRIAIIDDHQLFREGIKRILEFEGDFEVVAEGSDGSEVLSIVETYRPDLVLMDINMPD
INGVEATKQLIEAYPDTKVVVLSIHDDEHYVMRALQTGATGYLLKEMDADTLIEAVRIVA
EGGSYLHPKVTHNLIREYRRLTTEKGGAVMKQEVRRPLHLLTRRECEVLQLLADGKSNRA
IGEALYISEKTVKNHVSSILQKLNVNDRTQAVVVAIKNGWVEVR
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacacgcatcgcgattatcgacgatcaccagctgtttcgcgagggcatcaagcgc
attttagaatttgagggcgattttgaagtcgtggcggaaggcagcgacggaagcgaggtg
ctttcgatcgtcgaaacataccgcccggacttggtgctcatggacattaacatgccggac
atcaacggcgtggaggcgacgaaacagctgatcgaagcttaccctgatacgaaagtcgtc
gtgctgtcgattcatgacgatgaacactatgtcatgcgcgccttgcagacgggagcgacc
gggtatttgttgaaggagatggatgccgatacgctcattgaggcggtgagaatcgtcgcg
gaaggcggttcgtacttgcatccgaaagtgacgcacaacttgattcgcgaataccgccgc
ttgacgacggaaaaaggcggcgcagtgatgaagcaggaggtgcgccgtccgctgcatttg
ctgacgcggcgcgagtgcgaagtgctgcagctgttggccgacggcaaaagcaaccgcgcc
atcggcgaagcgctgtacatcagtgagaagaccgtcaaaaaccacgtcagcagcatcttg
caaaaattaaacgtcaacgaccggacgcaagccgttgtggttgcgatcaaaaacggctgg
gtcgaggtgcgctga

DBGET integrated database retrieval system