KEGG   Geobacillus thermocatenulatus: GT3921_03390Help
Entry
GT3921_03390      CDS       T05178                                 

Definition
(GenBank) hypothetical protein
Organism
gtm  Geobacillus thermocatenulatus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DZR zinc-ribbons_6 TackOD1 zf-C4pol Ribosomal_L32p RecR AbiEi_4 MetW zf-C2HC_2
Motif
Other DBs
NCBI-ProteinID: ASS98177
UniProt: A0A226Q980
LinkDB All DBs
Position
686296..686706
Genome map
AA seq 136 aa AA seqDB search
MAELVNCSKCGRLFVRLSTRDVCESCYQEEERQFERVYAFLRKRENRTATMAQVVEATGV
EEKLIIKWIRAGRLQLVHFPNLGYPCDSCGALIREGRLCAKCLGQLQADLRRAEREKEAE
DRSRRATYYSQDRKER
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggcggaactagtcaattgttcaaagtgcgggcggttgtttgtgagattatcgacacgt
gacgtgtgcgaatcgtgctatcaagaagaagagcggcaatttgaacgcgtttacgcgttt
ttgcgcaagcgggaaaaccgcacggcgacgatggcgcaagtggtggaggcgacaggcgtg
gaggagaagctgatcatcaaatggattcgcgcggggcggctgcagctcgtccattttccg
aatctcggctatccgtgcgactcgtgcggcgcgctgatccgtgaagggcggctgtgcgcc
aagtgtctcggccagctgcaggctgacttgcggagggcggagagggaaaaggaagcagaa
gatcgttcccgccgcgccacttattacagtcaagatcgtaaagagcgctaa

DBGET integrated database retrieval system